Recombinant Rotavirus A Non-structural glycoprotein 4 (52-175 aa) [6xHis-tag and Myc-tag], E. coli (CAT#: GPX04-394J)

Product Overview	Recombinant Rotavirus A (isolate RVA/Cow/United States/B223/1983/G10P8[11 ]) Non-structural glycoprotein 4 (52-175 aa) was expressed in E. coli with a 6xHis-tag at the N-terminus and a Myc-tag at the C-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP.
Biological Activity	Determined by its binding ability in a functional ELISA.
Source	E. coli
Species	Rotavirus A (isolate RVA/Cow/United States/B223/1983/G10P8[11 ])
Fragment	52-175 aa
Sequence	PTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMERVVKEMRRHFKMIDKLTTREIEQVGLLKRIHDKLDIRAVDEIDMTKEINQKNVRTLEEWEWGKNPYEPKEVTAAM
Tag	6xHis-tag at the N-terminus and Myc-tag at the C-terminus
Predicted MW	21.7 kDa
Purity	>90%, determined by SDS-PAGE.
Conjugation	Unconjugated

Target	Non-structural glycoprotein 4
Full Name	Non-structural glycoprotein 4
Uniprot ID	Q9PYC8
Background	Plays an essential role in the virus replication cycle by acting as a viroporin.
Alternate Names	NCVP5; NS28