0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Sabia mammarenavirus Pre-glycoprotein polyprotein GP complex (GPC) (255-488 aa), E. coli (CAT#: GPX04-401J)

Datasheet
SizeQtyAdd To Basket
1 mg
500 μg
100 μg

Product Overview Recombinant Sabia mammarenavirus (isolate Human/Brasil/SPH114202/1990) Pre-glycoprotein polyprotein GP complex (255-488 aa) was expressed in E. coli with a His-tag or Tag free. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP.
Biological Activity Determined by its binding ability in a functional ELISA.
Source E. coli
Species Sabia mammarenavirus (isolate Human/Brasil/SPH114202/1990)
Fragment 255-488 aa
Sequence GIFSWTITDAVGNDMPGGYCLERWMLVTSDLKCFGNTALAKCNLDHDSEFCDMLKLFEFN KKAIETLNDNTKNKVNLLTHSINALISDNLLMKNRLKELLNTPYCNYTKFWYVNHTASGE HSLPRCWLVRNNSYLNESEFRNDWIIESDHLLSEMLNKEYIDRQGKTPLTLVDICFWSTL FFTTTLFLHLVGFPTHRHIRGEPCPLPHRLNSRGGCRCGKYPELKKPITWHKNH
Tag His-tag or Tag free
Purity >90%, determined by SDS-PAGE.
Conjugation Unconjugated
Target GPC
Full Name Pre-glycoprotein polyprotein GP complex
Gene ID 3077252
Uniprot ID Q90037
Background Glycoprotein G2 is a class I viral fusion protein that directs fusion of viral and host endosomal membranes, leading to delivery of the nucleocapsid into the cytoplasm. Membrane fusion is mediated by irreversible conformational changes induced upon acidification in the endosome. Glycoprotein G1 interacts with the host receptor.
Alternate Names GPC; Pre-GP-C; Stable signal peptide; Glycoprotein G1; Glycoprotein G2
For Research Use Only.
Online Inquiry
Creative Biolabs-Glycoprotein Follow us on