Recombinant Schistosoma mansoni Antigenic integral membrane (69-160 aa) [His-Trx-Tag], E. coli (CAT#: GP02-074J)

Product Overview	Recombinant Schistosoma mansoni Antigenic integral membrane glycoprotein (69-160 aa) was expressed in E. coli with a 6xHis-Trx-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Source	E. coli
Species	Schistosoma mansoni
Fragment	69-160 aa
Sequence	VNSEENSNSIITDEDYDHYNSSLDSSNNVKHSQEAFHRNSDPDGFPEYEFLNETSIEIKEELGQELHQLQLILDELSRRIRATPNSANKYMK
Tag	6xHis-Trx-tag at the N-terminus
Predicted MW	28.9 kDa
Purity	>90%, determined by SDS-PAGE.
Conjugation	Unconjugated

Target	Antigenic integral membrane glycoprotein
Full Name	Antigenic integral membrane glycoprotein
Uniprot ID	P23126
Background	This protein is a major antigen in the surface tegument.
Alternate Names	Antigen Sm25