Recombinant Schistosoma mansoni (Blood fluke) Antigenic integral membrane glycoprotein (36-182 aa), E. coli (CAT#: GPX04-403J)

Product Overview	Recombinant Schistosoma mansoni (Blood fluke) Antigenic integral membrane glycoprotein (36-182 aa) was expressed in E. coli with a His-tag or Tag free. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP.
Biological Activity	Determined by its binding ability in a functional ELISA.
Source	E. coli
Species	Schistosoma mansoni (Blood fluke)
Fragment	36-182 aa
Sequence	DFSTEIIMIQTINWIVWKLFIIYISLDLFSLKLVNSEENSNSIITDEDYDHYNSSLDSSN NVKHSQEAFHRNSDPDGFPEYEFLNETSIEIKEELGQELHQLQLILDELSRRIRATPNSA NKYMKNEFLMSSCIVITLNLFIFMYKS
Tag	His-tag or Tag free
Purity	>90%, determined by SDS-PAGE.
Conjugation	Unconjugated

Target	Antigenic integral membrane glycoprotein
Full Name	Antigenic integral membrane glycoprotein
Uniprot ID	P23126
Background	Major antigen in the surface tegument.
Alternate Names	Antigen Sm25