There is no product in the shopping cart, buy it!
| Size | Qty | Add To Basket |
|---|---|---|
| 1 mg | ||
| 500 μg | ||
| 100 μg |
| Product Overview | Recombinant Schistosoma mansoni (Blood fluke) Antigenic integral membrane glycoprotein (36-182 aa) was expressed in E. coli with a His-tag or Tag free. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP. |
| Biological Activity | Determined by its binding ability in a functional ELISA. |
| Source | E. coli |
| Species | Schistosoma mansoni (Blood fluke) |
| Fragment | 36-182 aa |
| Sequence | DFSTEIIMIQTINWIVWKLFIIYISLDLFSLKLVNSEENSNSIITDEDYDHYNSSLDSSN NVKHSQEAFHRNSDPDGFPEYEFLNETSIEIKEELGQELHQLQLILDELSRRIRATPNSA NKYMKNEFLMSSCIVITLNLFIFMYKS |
| Tag | His-tag or Tag free |
| Purity | >90%, determined by SDS-PAGE. |
| Conjugation | Unconjugated |
| Target | Antigenic integral membrane glycoprotein |
| Full Name | Antigenic integral membrane glycoprotein |
| Uniprot ID | P23126 |
| Background | Major antigen in the surface tegument. |
| Alternate Names | Antigen Sm25 |