Recombinant Sumatran orangutan Neuronal membrane glycoprotein M6-b (GPM6B) (1-265 aa), E. coli (CAT#: GPX04-424J)

Product Overview	Recombinant Sumatran orangutan Neuronal membrane glycoprotein M6-b (NP_001126642.1) (1-265 aa) was expressed in E. coli with a His-tag or Tag free. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP.
Biological Activity	Determined by its binding ability in a functional ELISA.
Source	E. coli
Species	Sumatran orangutan
Fragment	1-265 aa
Sequence	MKPAMETAAEENTEQSQKRKGCFECCIKCLGGVPYASLVATILCFSGVALFCGCGHVALA GTVAILEQHFSTNASDHALLSEVIQLMQYVIYGIASFFFLYVIILLAEGFYTTSAVKELH GEFKTTACGRCISGMFVFLTYVLGVAWLGVFGFSAVPVFMFYNIWSTCEVIKSPQTNGTT GVEQICVDIRQYGIIPWNAFPGKICGSALENICNTNEFYMSYHLFIVACAGAGATVIALL IYMMATTYNYAVLKFKSREDCCTKF
Tag	His-tag or Tag free
Purity	>90%, determined by SDS-PAGE.
Conjugation	Unconjugated

Target	GPM6B
Full Name	Neuronal membrane glycoprotein M6-b
Gene ID	100173640
Uniprot ID	Q5R603
Accession Number	NP_001126642.1
Background	May be involved in neural development. Involved in regulation of osteoblast function and bone formation. Involved in matrix vesicle release by osteoblasts; this function seems to involve maintenance of the actin cytoskeleton. May be involved in cellular trafficking of SERT and thereby in regulation of serotonin uptake.
Alternate Names	Neuronal membrane glycoprotein M6-b