0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Human Neuronal membrane glycoprotein M6-b (GPM6B) (1-265 aa), E. coli (CAT#: GPX04-151J)

Datasheet
SizeQtyAdd To Basket
1 mg
500 μg
100 μg

Product Overview Recombinant Human Neuronal membrane glycoprotein M6-b (NP_001001994.1) (1-265 aa) was expressed in E. coli with a His-tag or Tag free. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP.
Biological Activity Determined by its binding ability in a functional ELISA.
Source E. coli
Species Human
Fragment 1-265 aa
Sequence MKPAMETAAEENTEQSQERKGCFECCIKCLGGVPYASLVATILCFSGVALFCGCGHVALA GTVAILEQHFSTNASDHALLSEVIQLMQYVIYGIASFFFLYGIILLAEGFYTTSAVKELH GEFKTTACGRCISGMFVFLTYVLGVAWLGVFGFSAVPVFMFYNIWSTCEVIKSPQTNGTT GVEQICVDIRQYGIIPWNAFPGKICGSALENICNTNEFYMSYHLFIVACAGAGATVIALL IYMMATTYNYAVLKFKSREDCCTKF
Tag His-tag or Tag free
Purity >90%, determined by SDS-PAGE.
Conjugation Unconjugated
Target GPM6B
Full Name Neuronal membrane glycoprotein M6-b
Gene ID 2824
Uniprot ID Q13491
Accession Number NP_001001994.1
Background May be involved in neural development. Involved in regulation of osteoblast function and bone formation. Involved in matrix vesicle release by osteoblasts; this function seems to involve maintenance of the actin cytoskeleton. May be involved in cellular trafficking of SERT and thereby in regulation of serotonin uptake.
Alternate Names Neuronal membrane glycoprotein M6-b
For Research Use Only.
Online Inquiry
Creative Biolabs-Glycoprotein Follow us on