Recombinant Bat coronavirus 133/2005 (BtCoV) Spike glycoprotein (S) (372-611 aa) [His/Myc-Tag], E. coli (CAT#: GP02-099J)

Product Overview	Recombinant Bat coronavirus 133/2005 (BtCoV) Spike glycoprotein (372-611 aa) was expressed in E. coli with a 10xHis-tag at the N-terminus and a Myc-tag at the C-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Source	E. coli
Species	Bat coronavirus 133/2005 (BtCoV)
Fragment	372-611 aa
Sequence	EASATGTFIEQPNVTECDFSPMLTGVAPQVYNFKRLVFSNCNYNLTKLLSLFAVDEFSCNGISPDAIARGCYSTLTVDYFAYPLSMKSYIRPGSAGNIPLYNYKQSFANPTCRVMASVPDNVTITKPGAYGYISKCSRLTGVNQDIETPLYINPGEYSICRDFAPLGFSEDGQVFKRTLTQFEGGGLLIGVGTRVPMTANLEMGFVISVQYGTGTDSVCPMLDLGDSLTITNRLGKCVDY
Tag	10xHis-tag at the N-terminus and Myc-tag at the C-terminus
Predicted MW	33.6 kDa
Purity	>95%, determined by SDS-PAGE.
Conjugation	Unconjugated

Target	S
Full Name	Spike glycoprotein
Uniprot ID	Q0Q4F2
Background	Spike protein S1 attaches the virion to the cell membrane by interacting with host receptor, initiating the infection. Spike protein S2 mediates fusion of the virion and cellular membranes by acting as a class I viral fusion protein.
Alternate Names	S glycoprotein; E2; Peplomer protein