Recombinant Human herpesvirus 5 (HHV-5) (strain Merlin) Envelope glycoprotein N (gN) (20-135 aa), E. coli (CAT#: GPX04-207J)

Product Overview	Recombinant Human herpesvirus 5 (HHV-5) (strain Merlin) Envelope glycoprotein N (20-135 aa) was expressed in E. coli with a His-tag or Tag free. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP.
Biological Activity	Determined by its binding ability in a functional ELISA.
Source	E. coli
Species	Human herpesvirus 5 (HHV-5) (strain Merlin)
Fragment	20-135 aa
Sequence	NNTSTASTPRPSSSTHASTTVKATTVATTSTTTATSTSSTTSAKPGSTTHDPNVMRPHAH NDFYNAHCTSHMYELSLSSFAAWWTMLNALILMGAFCIVLRHCCFQNFTATTTKGY
Tag	His-tag or Tag free
Purity	>90%, determined by SDS-PAGE.
Conjugation	Unconjugated

Target	gN
Full Name	Envelope glycoprotein N
Gene ID	3077417
Uniprot ID	F5HHQ0
Background	Envelope glycoprotein necessary for proper maturation of gM and modulation of its membrane fusion activity. Plays also a critical role in virion morphogenesis.
Alternate Names	Envelope glycoprotein N