0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Psittacid herpesvirus 1 (PsHV-1) (isolate Amazon parrot/-/97-0001/1997) Envelope glycoprotein N (gN) (28-115 aa), E. coli (CAT#: GPX04-344J)

Datasheet
SizeQtyAdd To Basket
1 mg
500 μg
100 μg

Product Overview Recombinant Psittacid herpesvirus 1 (PsHV-1) (isolate Amazon parrot/-/97-0001/1997) Envelope glycoprotein N (NP_944385.1) (28-115 aa) was expressed in E. coli with a His-tag or Tag free. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP.
Biological Activity Determined by its binding ability in a functional ELISA.
Source E. coli
Species Psittacid herpesvirus 1 (PsHV-1) (isolate Amazon parrot/-/97-0001/1997)
Fragment 28-115 aa
Sequence AQLDAGILNPWGSAGHNDAVMPGMFANSESDERFYSPHCSSRGLPLVNESMASVIFFLSL AMVCVAIVAILYNCCFNSFKNSVINSRW
Tag His-tag or Tag free
Purity >90%, determined by SDS-PAGE.
Conjugation Unconjugated
Target gN
Full Name Envelope glycoprotein N
Gene ID 2657019
Uniprot ID Q6UDL9
Accession Number NP_944385.1
Background Envelope glycoprotein necessary for proper maturation of gM and modulation of its membrane fusion activity. Plays also a critical role in virion morphogenesis.
Alternate Names Envelope glycoprotein N
For Research Use Only.
Online Inquiry
Creative Biolabs-Glycoprotein Follow us on
  • ()
    ()
    ()
ISO 9001 Certified - Creative Biolabs Quality Management System.
Close
Thanksgiving
Thanksgiving