Recombinant Cynomolgus monkey Myelin-oligodendrocyte glycoprotein (MOG) (30-247 aa), E. coli (CAT#: GPX04-072J)

Product Overview	Recombinant Cynomolgus monkey Myelin-oligodendrocyte glycoprotein (NP_001271785.1) (30-247 aa) was expressed in E. coli with a His-tag or Tag free. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP.
Biological Activity	Determined by its binding ability in a functional ELISA.
Source	E. coli
Species	Cynomolgus monkey
Fragment	30-247 aa
Sequence	GQFRVIGPRQPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGRDQDGE QAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAIELKVEDPFY WVSPAVLVLLAVLPVLLLQITVGLVFLCLQYRLRGKLRAEIENLHRTFDPHFLRVPCWKI TLFVIVPVLGPLVALIICYNWLHRRLAGQFLEELRNPF
Tag	His-tag or Tag free
Purity	>90%, determined by SDS-PAGE.
Conjugation	Unconjugated

Target	MOG
Full Name	Myelin-oligodendrocyte glycoprotein
Gene ID	102118842
Uniprot ID	Q9BGS7
Accession Number	NP_001271785.1
Background	Myelin oligodendrocyte glycoprotein (MOG) is a glycoprotein believed to be important in the myelination of nerves in the central nervous system (CNS).
Alternate Names	Myelin-oligodendrocyte glycoprotein