Recombinant White-tufted-ear marmoset Myelin-oligodendrocyte glycoprotein (MOG) (28-245 aa), E. coli (CAT#: GPX04-455J)

Product Overview	Recombinant White-tufted-ear marmosetMyelin-oligodendrocyte glycoprotein (100400400) (28-245 aa) was expressed in E. coli with a His-tag or Tag free. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP.
Biological Activity	Determined by its binding ability in a functional ELISA.
Source	E. coli
Species	White-tufted-ear marmoset
Fragment	28-245 aa
Sequence	GQFRVIGPSHPIQALVGDAAELPCRISPGKNATGMEVGWYRSPFSRVVHLYRNGKDQDGE QAPEYRGRTELLKDDIGEGKVTLKIRNVRFPDEGGFTCFFRDHSYQEEAAMQLKVEDPFY WVSPGVLVLLAVLPVLFLQITVGLVFLYLQHRLRGKLRAEIENLHRTFDPHFLRVPCWKI TLFVIVPVLGPLVALIICYNWLHRRLAGQFLEELRNPF
Tag	His-tag or Tag free
Purity	>90%, determined by SDS-PAGE.
Conjugation	Unconjugated

Target	MOG
Full Name	Myelin-oligodendrocyte glycoprotein
Gene ID	100400400
Uniprot ID	Q29ZQ1
Accession Number	NP_001244171.1
Background	Minor component of the myelin sheath. May be involved in completion and/or maintenance of the myelin sheath and in cell-cell communication.
Alternate Names	Myelin-oligodendrocyte glycoprotein