Recombinant Sumatran orangutan Myelin-oligodendrocyte glycoprotein (MOG) (29-246 aa), E. coli (CAT#: GPX04-422J)

Product Overview	Recombinant Sumatran orangutan Myelin-oligodendrocyte glycoprotein (NP_001125993.1) (29-246 aa) was expressed in E. coli with a His-tag or Tag free. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP.
Biological Activity	Determined by its binding ability in a functional ELISA.
Source	E. coli
Species	Sumatran orangutan
Fragment	29-246 aa
Sequence	GQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGE QAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFY WVSPGVLVLLAVLPVLLLQIAVGLVFLCLQYRLRGKLRAEIENLHRTFDPHFLRVPCWKI TLFVIVPVLGPLVALIICYNWLHRRLAGQFLEELRNPF
Tag	His-tag or Tag free
Purity	>90%, determined by SDS-PAGE.
Conjugation	Unconjugated

Target	MOG
Full Name	Myelin-oligodendrocyte glycoprotein
Gene ID	100172932
Uniprot ID	Q5R960
Accession Number	NP_001125993.1
Background	Minor component of the myelin sheath. May be involved in completion and/or maintenance of the myelin sheath and in cell-cell communication.
Alternate Names	Myelin-oligodendrocyte glycoprotein