0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Sumatran orangutan Myelin-oligodendrocyte glycoprotein (MOG) (29-246 aa), E. coli (CAT#: GPX04-422J)

Datasheet
SizeQtyAdd To Basket
1 mg
500 μg
100 μg

Product Overview Recombinant Sumatran orangutan Myelin-oligodendrocyte glycoprotein (NP_001125993.1) (29-246 aa) was expressed in E. coli with a His-tag or Tag free. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP.
Biological Activity Determined by its binding ability in a functional ELISA.
Source E. coli
Species Sumatran orangutan
Fragment 29-246 aa
Sequence GQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGE QAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFY WVSPGVLVLLAVLPVLLLQIAVGLVFLCLQYRLRGKLRAEIENLHRTFDPHFLRVPCWKI TLFVIVPVLGPLVALIICYNWLHRRLAGQFLEELRNPF
Tag His-tag or Tag free
Purity >90%, determined by SDS-PAGE.
Conjugation Unconjugated
Target MOG
Full Name Myelin-oligodendrocyte glycoprotein
Gene ID 100172932
Uniprot ID Q5R960
Accession Number NP_001125993.1
Background Minor component of the myelin sheath. May be involved in completion and/or maintenance of the myelin sheath and in cell-cell communication.
Alternate Names Myelin-oligodendrocyte glycoprotein
For Research Use Only.
Online Inquiry
Creative Biolabs-Glycoprotein Follow us on