0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Human Alpha-1-b glycoprotein (A1BG) [His-Tag], E. coli (CAT#: GP01-011J)

Datasheet
SizeQtyAdd To Basket
10 μg
50 μg
200 μg

Product Overview Recombinant Human Alpha-1-b glycoprotein (A1BG) (NP_570602.2) (Ala22-Ala206) was expressed in E. coli with a His-Tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Biological Activity Determined by its binding ability in a functional ELISA.
Source E. coli
Species Human
Fragment Ala22-Ala206
Sequence MGHHHHHHSGSEFAIFYETQPSLWAESESLLKPLANVTLTCQAHLETPDFQLFKNGVAQEPVHLDSPAIKHQFLLTGDTQGRYRCRSGLSTGWTQLSKLLELTGPKSLPAPWLSMAPVSWITPGLKTTAVCRGVLRGVTFLLRREGDHEFLEVPEAQEDVEATFPVHQPGNYSCSYRTDGEGALSEPSATVTIEELAA
Tag His-Tag at the N-terminus
Predicted MW 21.8 KDa
Purity >95%, determined by SDS-PAGE and HPLC
Endotoxin Level <1 EU/μg, determined by the LAL method
Conjugation Unconjugated
Target A1BG
Full Name Alpha-1-b glycoprotein
Gene ID 1
Uniprot ID P04217
Accession Number NP_570602.2
Background The protein encoded by this gene is a plasma glycoprotein of unknown function. The protein shows sequence similarity to the variable regions of some immunoglobulin supergene family member proteins.
Alternate Names A1B; ABG; GAB; HYST2477; A1BG; Alpha-1-b glycoprotein
For Research Use Only.
Online Inquiry
Creative Biolabs-Glycoprotein Follow us on
Close
Thanksgiving
Thanksgiving