There is no product in the shopping cart, buy it!
Size | Qty | Add To Basket |
---|---|---|
10 μg | ||
50 μg | ||
200 μg |
Product Overview | Recombinant Human Alpha-1-b glycoprotein (A1BG) (NP_570602.2) (Ala22-Ala206) was expressed in E. coli with a His-Tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP. |
Biological Activity | Determined by its binding ability in a functional ELISA. |
Source | E. coli |
Species | Human |
Fragment | Ala22-Ala206 |
Sequence | MGHHHHHHSGSEFAIFYETQPSLWAESESLLKPLANVTLTCQAHLETPDFQLFKNGVAQEPVHLDSPAIKHQFLLTGDTQGRYRCRSGLSTGWTQLSKLLELTGPKSLPAPWLSMAPVSWITPGLKTTAVCRGVLRGVTFLLRREGDHEFLEVPEAQEDVEATFPVHQPGNYSCSYRTDGEGALSEPSATVTIEELAA |
Tag | His-Tag at the N-terminus |
Predicted MW | 21.8 KDa |
Purity | >95%, determined by SDS-PAGE and HPLC |
Endotoxin Level | <1 EU/μg, determined by the LAL method |
Conjugation | Unconjugated |
Target | A1BG |
Full Name | Alpha-1-b glycoprotein |
Gene ID | 1 |
Uniprot ID | P04217 |
Accession Number | NP_570602.2 |
Background | The protein encoded by this gene is a plasma glycoprotein of unknown function. The protein shows sequence similarity to the variable regions of some immunoglobulin supergene family member proteins. |
Alternate Names | A1B; ABG; GAB; HYST2477; A1BG; Alpha-1-b glycoprotein |