Recombinant Human Alpha-1-b glycoprotein (A1BG) [His-Tag], E. coli (CAT#: GP01-011J)

Product Overview	Recombinant Human Alpha-1-b glycoprotein (A1BG) (NP_570602.2) (Ala22-Ala206) was expressed in E. coli with a His-Tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Biological Activity	Determined by its binding ability in a functional ELISA.
Source	E. coli
Species	Human
Fragment	Ala22-Ala206
Sequence	MGHHHHHHSGSEFAIFYETQPSLWAESESLLKPLANVTLTCQAHLETPDFQLFKNGVAQEPVHLDSPAIKHQFLLTGDTQGRYRCRSGLSTGWTQLSKLLELTGPKSLPAPWLSMAPVSWITPGLKTTAVCRGVLRGVTFLLRREGDHEFLEVPEAQEDVEATFPVHQPGNYSCSYRTDGEGALSEPSATVTIEELAA
Tag	His-Tag at the N-terminus
Predicted MW	21.8 KDa
Purity	>95%, determined by SDS-PAGE and HPLC
Endotoxin Level	<1 EU/μg, determined by the LAL method
Conjugation	Unconjugated

Target	A1BG
Full Name	Alpha-1-b glycoprotein
Gene ID	1
Uniprot ID	P04217
Accession Number	NP_570602.2
Background	The protein encoded by this gene is a plasma glycoprotein of unknown function. The protein shows sequence similarity to the variable regions of some immunoglobulin supergene family member proteins.
Alternate Names	A1B; ABG; GAB; HYST2477; A1BG; Alpha-1-b glycoprotein