0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Human CD3e molecule (CD3E) (23-207 aa) [GST-Tag], E. coli (CAT#: GP02-008J)

Datasheet
SizeQtyAdd To Basket
100 μg
1 mg

Product Overview Recombinant Human CD3e molecule (NP_000724.1) (23-207 aa) was expressed in E. coli with a GST-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Source E. coli
Species Human
Fragment 23-207 aa
Sequence DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI
Tag GST-tag at the N-terminus
Predicted MW 47.7 kDa
Purity >95%, determined by SDS-PAGE.
Conjugation Unconjugated
Target CD3E
Full Name CD3e molecule
Gene ID 916
Uniprot ID P07766
Accession Number NP_000724.1
Background The protein is the CD3-epsilon polypeptide, which together with CD3-gamma, -delta and -zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T-cell receptor-CD3 complex. This complex plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways.
Alternate Names T3E; TCRE; IMD18
For Research Use Only.
Online Inquiry
Creative Biolabs-Glycoprotein Follow us on