Recombinant Human CD3e molecule (CD3E) (23-207 aa) [GST-Tag], E. coli (CAT#: GP02-008J)

Product Overview	Recombinant Human CD3e molecule (NP_000724.1) (23-207 aa) was expressed in E. coli with a GST-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Source	E. coli
Species	Human
Fragment	23-207 aa
Sequence	DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI
Tag	GST-tag at the N-terminus
Predicted MW	47.7 kDa
Purity	>95%, determined by SDS-PAGE.
Conjugation	Unconjugated

Target	CD3E
Full Name	CD3e molecule
Gene ID	916
Uniprot ID	P07766
Accession Number	NP_000724.1
Background	The protein is the CD3-epsilon polypeptide, which together with CD3-gamma, -delta and -zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T-cell receptor-CD3 complex. This complex plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways.
Alternate Names	T3E; TCRE; IMD18