0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Human T-cell surface glycoprotein CD3 epsilon chain (CD3E) (23-207 aa), E. coli (CAT#: GPX04-143J)

Datasheet
SizeQtyAdd To Basket
1 mg
500 μg
100 μg

Product Overview Recombinant Human T-cell surface glycoprotein CD3 epsilon chain (NP_000724.1) (23-207 aa) was expressed in E. coli with a His-tag or Tag free. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP.
Biological Activity Determined by its binding ability in a functional ELISA.
Source E. coli
Species Human
Fragment 23-207 aa
Sequence DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI
Tag His-tag or Tag free
Purity >90%, determined by SDS-PAGE.
Conjugation Unconjugated
Target CD3E
Full Name T-cell surface glycoprotein CD3 epsilon chain
Gene ID 916
Uniprot ID P07766
Accession Number NP_000724.1
Background Part of the TCR-CD3 complex present on T-lymphocyte cell surface that plays an essential role in adaptive immune response. When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G and CD3Z. All CD3 chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain. Upon TCR engagement, these motifs become phosphorylated by Src family protein tyrosine kinases LCK and FYN, resulting in the activation of downstream signaling pathways.
Alternate Names T-cell surface antigen T3/Leu-4 epsilon chain; CD3e
For Research Use Only.
Online Inquiry
Creative Biolabs-Glycoprotein Follow us on