0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Mouse CD3 antigen, epsilon polypeptide (Cd3e) (23-108 aa) [His-Tag], Yeast (CAT#: GP02-007J)

Datasheet
SizeQtyAdd To Basket
100 μg
500 μg

Product Overview Recombinant Mouse CD3 antigen, epsilon polypeptide (NP_031674.1) (23-108 aa) was expressed in Yeast with a 6xHis-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Source Yeast
Species Mouse
Fragment 23-108 aa
Sequence DAENIEYKVSISGTSVELTCPLDSDENLKWEKNGQELPQKHDKHLVLQDFSEVEDSGYYVCYTPASNKNTYLYLKARVCEYCVEVD
Tag 6xHis-tag at the N-terminus
Predicted MW 11.9 kDa
Purity >95%, determined by SDS-PAGE.
Conjugation Unconjugated
Target Cd3e
Full Name CD3 antigen, epsilon polypeptide
Gene ID 12501
Uniprot ID P22646
Accession Number NP_031674.1
Background This protein is a part of the TCR-CD3 complex present on T-lymphocyte cell surface that plays an essential role in adaptive immune response.
Alternate Names CD3; T3e; AI504783; CD3epsilon
For Research Use Only.
Online Inquiry
Creative Biolabs-Glycoprotein Follow us on
Close
Thanksgiving
Thanksgiving