Recombinant Mouse CD3 antigen, epsilon polypeptide (Cd3e) (23-108 aa) [His-Tag], Yeast (CAT#: GP02-007J)

Product Overview	Recombinant Mouse CD3 antigen, epsilon polypeptide (NP_031674.1) (23-108 aa) was expressed in Yeast with a 6xHis-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Source	Yeast
Species	Mouse
Fragment	23-108 aa
Sequence	DAENIEYKVSISGTSVELTCPLDSDENLKWEKNGQELPQKHDKHLVLQDFSEVEDSGYYVCYTPASNKNTYLYLKARVCEYCVEVD
Tag	6xHis-tag at the N-terminus
Predicted MW	11.9 kDa
Purity	>95%, determined by SDS-PAGE.
Conjugation	Unconjugated

Target	Cd3e
Full Name	CD3 antigen, epsilon polypeptide
Gene ID	12501
Uniprot ID	P22646
Accession Number	NP_031674.1
Background	This protein is a part of the TCR-CD3 complex present on T-lymphocyte cell surface that plays an essential role in adaptive immune response.
Alternate Names	CD3; T3e; AI504783; CD3epsilon