There is no product in the shopping cart, buy it!
Size | Qty | Add To Basket |
---|---|---|
100 μg | ||
1 mg |
Product Overview | Recombinant Mouse Epithelial cell adhesion molecule (NP_032558.2) (24-266 aa) was expressed in E. coli with Tag-free. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP. |
Source | E. coli |
Species | Mouse |
Fragment | 24-266 aa |
Sequence | QRDCVCDNYKLATSCSLNEYGECQCTSYGTQNTVICSKLASKCLAMKAEMTHSKSGRRIKPEGAIQNNDGLYDPDCDEQGLFKAKQCNGTATCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKERESPYDHQSLQTALQEAFTSRYKLNQKFIKNIMYENNVITIDLMQNSSQKTQDDVDIADVAYYFEKDVKGESLFHSSKSMDLRVNGEPLDLDPGQTLIYYVDEKAPEFSMQGLT |
Tag | Tag-Free |
Predicted MW | 27.8 kDa |
Purity | >90%, determined by SDS-PAGE. |
Conjugation | Unconjugated |
Target | Epcam |
Full Name | Epithelial cell adhesion molecule |
Gene ID | 17075 |
Uniprot ID | Q99JW5 |
Accession Number | NP_032558.2 |
Background | This protein may act as a physical homophilic interaction molecule between intestinal epithelial cells (IECs) and intraepithelial lymphocytes (IELs) at the mucosal epithelium for providing immunological barrier as a first line of defense against mucosal infection. Plays a role in embryonic stem cells proliferation and differentiation. Up-regulates the expression of FABP5, MYC and cyclins A and E. |
Alternate Names | TR; EGP; EpC; Ly7; gp4; EGP-; Ep-C; EpCA; Ly74; gp40; CD326; EGP-2; Egp31; TROP1; Tacst; Egp314; Ep-CAM; EpCAM1; GA733-; Tacsd1; GA733-2; Tacstd1 |