Recombinant Human Glycoprotein vi platelet (GP6) [His-Tag], E. coli (CAT#: GP01-066J)

Product Overview	Recombinant Human Glycoprotein vi platelet (GP6) (NP_057447.5) (Tyr86-Thr231) was expressed in E. coli with a His-Tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Biological Activity	Determined by its binding ability in a functional ELISA.
Source	E. coli
Species	Human
Fragment	Tyr86-Thr231
Sequence	MGHHHHHHSGSYRCSYQNGSLWSLPSDQLELVATGVFAKPSLSAQPGPAVSSGGDVTLQCQTRYGFDQFALYKEGDPAPYKNPERWYRASFPIITVTAAHSGTYRCYSFSSRDPYLWSAPSDPLELVVTGTSVTPSRLPTEPPSPVAEFSEATAELT
Tag	His-Tag at the N-terminus
Predicted MW	17.2 KDa
Purity	>95%, determined by SDS-PAGE and HPLC
Endotoxin Level	<1 EU/μg, determined by the LAL method
Conjugation	Unconjugated

Target	GP6
Full Name	Glycoprotein vi platelet
Gene ID	51206
Uniprot ID	Q9HCN6
Accession Number	NP_057447.5
Background	This gene encodes a platelet membrane glycoprotein of the immunoglobulin superfamily. The encoded protein is a receptor for collagen and plays a critical role in collagen-induced platelet aggregation and thrombus formation. The encoded protein forms a complex with the Fc receptor gamma-chain that initiates the platelet activation signaling cascade upon collagen binding. Mutations in this gene are a cause of platelet-type bleeding disorder-11 (BDPLT11). Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Alternate Names	GPIV; GPVI; BDPLT11; GP6; Glycoprotein vi platelet