Recombinant Human Glycoprotein vi platelet (GP6) [His-Tag], E. coli

Recombinant Human Glycoprotein vi platelet (GP6) (NP_057447.5) (Tyr86-Thr231) was expressed in E. coli with a His-Tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.

Determined by its binding ability in a functional ELISA.

Human

Tyr86-Thr231

MGHHHHHHSGSYRCSYQNGSLWSLPSDQLELVATGVFAKPSLSAQPGPAVSSGGDVTLQCQTRYGFDQFALYKEGDPAPYKNPERWYRASFPIITVTAAHSGTYRCYSFSSRDPYLWSAPSDPLELVVTGTSVTPSRLPTEPPSPVAEFSEATAELT

His-Tag at the N-terminus

17.2 KDa

>95%, determined by SDS-PAGE and HPLC

<1 EU/μg, determined by the LAL method

Unconjugated

GP6

Glycoprotein vi platelet

This gene encodes a platelet membrane glycoprotein of the immunoglobulin superfamily. The encoded protein is a receptor for collagen and plays a critical role in collagen-induced platelet aggregation and thrombus formation. The encoded protein forms a complex with the Fc receptor gamma-chain that initiates the platelet activation signaling cascade upon collagen binding. Mutations in this gene are a cause of platelet-type bleeding disorder-11 (BDPLT11). Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.

GPIV; GPVI; BDPLT11; GP6; Glycoprotein vi platelet