0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Human Glycoprotein vi platelet (GP6) [His-Tag], E. coli (CAT#: GP01-066J)

Datasheet
SizeQtyAdd To Basket
10 μg
50 μg
200 μg

Product Overview Recombinant Human Glycoprotein vi platelet (GP6) (NP_057447.5) (Tyr86-Thr231) was expressed in E. coli with a His-Tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Biological Activity Determined by its binding ability in a functional ELISA.
Source E. coli
Species Human
Fragment Tyr86-Thr231
Sequence MGHHHHHHSGSYRCSYQNGSLWSLPSDQLELVATGVFAKPSLSAQPGPAVSSGGDVTLQCQTRYGFDQFALYKEGDPAPYKNPERWYRASFPIITVTAAHSGTYRCYSFSSRDPYLWSAPSDPLELVVTGTSVTPSRLPTEPPSPVAEFSEATAELT
Tag His-Tag at the N-terminus
Predicted MW 17.2 KDa
Purity >95%, determined by SDS-PAGE and HPLC
Endotoxin Level <1 EU/μg, determined by the LAL method
Conjugation Unconjugated
Target GP6
Full Name Glycoprotein vi platelet
Gene ID 51206
Uniprot ID Q9HCN6
Accession Number NP_057447.5
Background This gene encodes a platelet membrane glycoprotein of the immunoglobulin superfamily. The encoded protein is a receptor for collagen and plays a critical role in collagen-induced platelet aggregation and thrombus formation. The encoded protein forms a complex with the Fc receptor gamma-chain that initiates the platelet activation signaling cascade upon collagen binding. Mutations in this gene are a cause of platelet-type bleeding disorder-11 (BDPLT11). Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Alternate Names GPIV; GPVI; BDPLT11; GP6; Glycoprotein vi platelet
For Research Use Only.
Online Inquiry
Creative Biolabs-Glycoprotein Follow us on