There is no product in the shopping cart, buy it!
Size | Qty | Add To Basket |
---|---|---|
10 μg | ||
50 μg | ||
200 μg |
Product Overview | Recombinant Mouse Alpha-1-b glycoprotein (A1BG) (NP_001074536.1) (Met22-Ser219) was expressed in E. coli with a His-tag and S-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP. |
Biological Activity | Determined by its binding ability in a functional ELISA. |
Source | E. coli |
Species | Mouse |
Fragment | Met22-Ser219 |
Sequence | MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEFMLDSGSEPKLWAEPQSLLEPWANLTLVCAVDLPTKVFELIQNGWFLSQVRLETQVLSYRFSLGAITSNNSGIYRCRCGVEPPVDIHLPALNKWTMLSNAVEVTGKEPLPRPLAHADPVDWITPGGLPVYVMCQVAMRGVTYLLRQEGVDGVQKPDVQHKGTAGFLIYKPGNYSCSYLTHAAGEPSEPSDIVTIKMYAS |
Tag | His-tag and S-tag at the N-terminus |
Predicted MW | 27.5 KDa |
Purity | >95%, determined by SDS-PAGE and HPLC |
Endotoxin Level | <1 EU/μg, determined by the LAL method |
Conjugation | Unconjugated |
Target | A1BG |
Full Name | Alpha-1-b glycoprotein |
Gene ID | 117586 |
Uniprot ID | Q19LI2 |
Accession Number | NP_001074536.1 |
Background | Restricted expression toward liver adult (RPKM 526.2). |
Alternate Names | C44; A1BG; Alpha-1-b glycoprotein |