Recombinant Mouse Alpha-1-b glycoprotein (A1BG) (Met22-Ser219) [His-tag and S-tag], E. coli (CAT#: GP01-014J)

Product Overview	Recombinant Mouse Alpha-1-b glycoprotein (A1BG) (NP_001074536.1) (Met22-Ser219) was expressed in E. coli with a His-tag and S-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Biological Activity	Determined by its binding ability in a functional ELISA.
Source	E. coli
Species	Mouse
Fragment	Met22-Ser219
Sequence	MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEFMLDSGSEPKLWAEPQSLLEPWANLTLVCAVDLPTKVFELIQNGWFLSQVRLETQVLSYRFSLGAITSNNSGIYRCRCGVEPPVDIHLPALNKWTMLSNAVEVTGKEPLPRPLAHADPVDWITPGGLPVYVMCQVAMRGVTYLLRQEGVDGVQKPDVQHKGTAGFLIYKPGNYSCSYLTHAAGEPSEPSDIVTIKMYAS
Tag	His-tag and S-tag at the N-terminus
Predicted MW	27.5 KDa
Purity	>95%, determined by SDS-PAGE and HPLC
Endotoxin Level	<1 EU/μg, determined by the LAL method
Conjugation	Unconjugated

Target	A1BG
Full Name	Alpha-1-b glycoprotein
Gene ID	117586
Uniprot ID	Q19LI2
Accession Number	NP_001074536.1
Background	Restricted expression toward liver adult (RPKM 526.2).
Alternate Names	C44; A1BG; Alpha-1-b glycoprotein