There is no product in the shopping cart, buy it!
| Size | Qty | Add To Basket |
|---|---|---|
| 1 mg | ||
| 500 μg | ||
| 100 μg |
| Product Overview | Recombinant Suid herpesvirus 1 (strain Rice) (SuHV-1) Envelope glycoprotein E (21-428 aa) was expressed in E. coli with a His-tag or Tag free. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP. |
| Biological Activity | Determined by its binding ability in a functional ELISA. |
| Source | E. coli |
| Species | Suid herpesvirus 1 (strain Rice) (SuHV-1) |
| Fragment | 21-428 aa |
| Sequence | TEAPSLSAETTPGPVTEVPSPSAEVWDLSTEAGDDDLDGDLNGDDRRAGFGSALASLREA PPAHLVNVSEGANFTLDARGDGAVVAGIWTFLPVRGCDAVAVTMVCFETACHPDLVLGRA CVPEAPERGIGDYLPPEVPRLQREPPIVTPERWSPHLTVRRATPNDTGLYTLHDASGPRA VFFVAVGDRPPAPLAPVGPARHEPRFHALGFHSQLFSPGDTFDLMPRVVSDMGDSRENFT ATLDWYYARAPPRCLLYYVYEPCIYHPRAPECLRPVDPACSFTSPARAALVARRAYASCS PLLGDRWLTACPFDAFGEEVHTNATADESGLYVLVMTHNGHVATWDYTLVATAAEYVTVI KELTAPARAPGTPWGPGGGDDAIYVDGVTTPAPPARPWNPYGRTTPGR |
| Tag | His-tag or Tag free |
| Purity | >90%, determined by SDS-PAGE. |
| Conjugation | Biotin |
| Target | gE |
| Full Name | Envelope glycoprotein E |
| Uniprot ID | P08354 |
| Background | In epithelial cells, the heterodimer gE/gI is required for the cell-to-cell spread of the virus, by sorting nascent virions to cell junctions. Once the virus reaches the cell junctions, virus particles can spread to adjacent cells extremely rapidly through interactions with cellular receptors that accumulate at these junctions. |
| Alternate Names | Envelope glycoprotein E; gE |