Recombinant Equine herpesvirus 1 (EHV-1) (strain AB1) Envelope glycoprotein E (gE) (24-550 aa), E. coli (CAT#: GPX04-086J)

Product Overview	Recombinant Equine herpesvirus 1 (EHV-1) (strain AB1) Envelope glycoprotein E (24-550 aa) was expressed in E. coli with a His-tag or Tag free. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP.
Biological Activity	Determined by its binding ability in a functional ELISA.
Source	E. coli
Species	Equine herpesvirus 1 (EHV-1) (strain AB1)
Fragment	24-550 aa
Sequence	VQQVELSEGAWAMIDGRDVLTPTNTTTRVTKAWTFLETPPGCAGDISVKKVCVSHSLCED NIIIGKHCNLLTGEHGIALAEFNVVNGSLRRTDDVYFVNGTVFPILAETRSVLQIHRATP SIAGVYTLHVSIDGMMKHSVVLLTVKKPPKQPQPRLRVKTPPPVTVPQVPVKTHTDFVVH GYHSRVYADGESFELSVNLESHIVEPSFSAEIQWYYMNTSSSSCDLFRVFETCIFHPTAM ACLHPEQHTCSFTSPIRATKILHRVYGNCSDHGNSWPSRCHSTLLGNRLYFIQPAQNRVD LLFKDTPASATGLYVFVLLYNGHPEAWTYTLLSTANHFMNVLTDVTRPRLGEHFYTDLGH KIITPHPSVATTEELGAWTRHYLAFLLVIICTCAALLVALVVWGCILYIRSNRKPYEVLN PFETVYTSVPSNDPSDEVLVFERLASDSDDSFDSDSDEELEYPPPPKPAPQLPPYQFVDG GDAPSGRSGFKVWFRDTPEASPVPLHKPTLQGPDYSRVASKLKSILK
Tag	His-tag or Tag free
Purity	>90%, determined by SDS-PAGE.
Conjugation	Unconjugated

Target	gE
Full Name	Envelope glycoprotein E
Gene ID	2948576
Uniprot ID	P68328
Background	In epithelial cells, the heterodimer gE/gI is required for the cell-to-cell spread of the virus, by sorting nascent virions to cell junctions. Once the virus reaches the cell junctions, virus particles can spread to adjacent cells extremely rapidly through interactions with cellular receptors that accumulate at these junctions. Implicated in basolateral spread in polarized cells. In neuronal cells, gE/gI is essential for the anterograde spread of the infection throughout the host nervous system. Together with US9, the heterodimer gE/gI is involved in the sorting and transport of viral structural components toward axon tips.
Alternate Names	Envelope glycoprotein E