Recombinant Human Biglycan (BGN) protein (Thr230-Tyr366) [His-Tag], E. coli (CAT#: GP01-029J)

Product Overview	Recombinant Human Biglycan (BGN) protein (NP_001702.1) (Thr230-Tyr366) was expressed in E. coli with a His-Tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Biological Activity	Determined by its binding ability in a functional ELISA.
Source	E. coli
Species	Human
Fragment	Thr230-Tyr366
Sequence	MGHHHHHHSGSEFTLNELHLDHNKIQAIELEDLLRYSKLYRLGLGHNQIRMIENGSLSFLPTLRELHLDNNKLARVPSGLPDLKLLQVVYLHSNNITKVGVNDFCPMGFGVKRAYYNGISLFNNPVPYWEVQPATFRCVTDRLAIQFGNY
Tag	His-Tag at the N-terminus
Predicted MW	17.3 KDa
Purity	>95%, determined by SDS-PAGE and HPLC
Endotoxin Level	<1 EU/μg, determined by the LAL method
Conjugation	Unconjugated

Target	BGN
Full Name	Biglycan
Gene ID	633
Uniprot ID	P21810
Accession Number	NP_001702.1
Background	This gene encodes a member of the small leucine-rich proteoglycan (SLRP) family of proteins. The encoded preproprotein is proteolytically processed to generate the mature protein, which plays a role in bone growth, muscle development and regeneration, and collagen fibril assembly in multiple tissues. This protein may also regulate inflammation and innate immunity. Additionally, the encoded protein may contribute to atherosclerosis and aortic valve stenosis in human patients. This gene and the related gene decorin are thought to be the result of a gene duplication.
Alternate Names	PGI; MRLS; DSPG1; PG-S1; SEMDX; SLRR1A; BGN; Biglycan