There is no product in the shopping cart, buy it!
Size | Qty | Add To Basket |
---|---|---|
10 μg | ||
50 μg | ||
200 μg |
Product Overview | Recombinant Human Biglycan (BGN) protein (NP_001702.1) (Val49-Leu182) was expressed in E. coli with a His-Tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP. |
Biological Activity | Determined by its binding ability in a functional ELISA. |
Source | E. coli |
Species | Human |
Fragment | Val49-Leu182 |
Sequence | MGHHHHHHSGSEFVLDPDSVTPTYSAMCPFGCHCHLRVVQCSDLGLKSVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVFSGL |
Tag | His-Tag at the N-terminus |
Predicted MW | 16.6 KDa |
Purity | >95%, determined by SDS-PAGE and HPLC |
Endotoxin Level | <1 EU/μg, determined by the LAL method |
Conjugation | Unconjugated |
Target | BGN |
Full Name | Biglycan |
Gene ID | 633 |
Uniprot ID | P21810 |
Accession Number | NP_001702.1 |
Background | This gene encodes a member of the small leucine-rich proteoglycan (SLRP) family of proteins. The encoded preproprotein is proteolytically processed to generate the mature protein, which plays a role in bone growth, muscle development and regeneration, and collagen fibril assembly in multiple tissues. This protein may also regulate inflammation and innate immunity. Additionally, the encoded protein may contribute to atherosclerosis and aortic valve stenosis in human patients. This gene and the related gene decorin are thought to be the result of a gene duplication. |
Alternate Names | PGI; MRLS; DSPG1; PG-S1; SEMDX; SLRR1A; BGN; Biglycan |