0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Human Biglycan (BGN) protein (Val49-Leu182) [His-Tag], E. coli (CAT#: GP01-028J)

Datasheet
SizeQtyAdd To Basket
10 μg
50 μg
200 μg

Product Overview Recombinant Human Biglycan (BGN) protein (NP_001702.1) (Val49-Leu182) was expressed in E. coli with a His-Tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Biological Activity Determined by its binding ability in a functional ELISA.
Source E. coli
Species Human
Fragment Val49-Leu182
Sequence MGHHHHHHSGSEFVLDPDSVTPTYSAMCPFGCHCHLRVVQCSDLGLKSVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVFSGL
Tag His-Tag at the N-terminus
Predicted MW 16.6 KDa
Purity >95%, determined by SDS-PAGE and HPLC
Endotoxin Level <1 EU/μg, determined by the LAL method
Conjugation Unconjugated
Target BGN
Full Name Biglycan
Gene ID 633
Uniprot ID P21810
Accession Number NP_001702.1
Background This gene encodes a member of the small leucine-rich proteoglycan (SLRP) family of proteins. The encoded preproprotein is proteolytically processed to generate the mature protein, which plays a role in bone growth, muscle development and regeneration, and collagen fibril assembly in multiple tissues. This protein may also regulate inflammation and innate immunity. Additionally, the encoded protein may contribute to atherosclerosis and aortic valve stenosis in human patients. This gene and the related gene decorin are thought to be the result of a gene duplication.
Alternate Names PGI; MRLS; DSPG1; PG-S1; SEMDX; SLRR1A; BGN; Biglycan
For Research Use Only.
Online Inquiry
  • (USA)
    (UK)
    (Germany)
  • Contact Us
  • Global Locations
Follow us on