0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Rat Biglycan (BGN) protein [His-Tag], E. coli (CAT#: GP01-032J)

Datasheet
SizeQtyAdd To Basket
10 μg
50 μg
200 μg

Product Overview Recombinant Rat Biglycan (BGN) protein (NP_058783.1) (Ser48-Leu158) was expressed in E. coli with a His-Tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Biological Activity Determined by its binding ability in a functional ELISA.
Source E. coli
Species Rat
Fragment Ser48-Leu158
Sequence MGHHHHHHSGSEFSGVPDLDSLTPTFSAMCPFGCHCHLRVVQCSDLGLKTVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNL
Tag His-Tag at the N-terminus
Predicted MW 14 KDa
Purity >95%, determined by SDS-PAGE and HPLC
Endotoxin Level <1 EU/μg, determined by the LAL method
Conjugation Unconjugated
Target BGN
Full Name Biglycan
Gene ID 25181
Uniprot ID P47853
Accession Number NP_058783.1
Background This protein may play a role in vascular remodeling.
Alternate Names BSPG1; BGN; Biglycan
For Research Use Only.
Online Inquiry
  • (USA)
    (UK)
    (Germany)
  • Contact Us
  • Global Locations
Follow us on