Recombinant Rat Biglycan (BGN) protein [His-Tag], E. coli (CAT#: GP01-032J)

Product Overview	Recombinant Rat Biglycan (BGN) protein (NP_058783.1) (Ser48-Leu158) was expressed in E. coli with a His-Tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Biological Activity	Determined by its binding ability in a functional ELISA.
Source	E. coli
Species	Rat
Fragment	Ser48-Leu158
Sequence	MGHHHHHHSGSEFSGVPDLDSLTPTFSAMCPFGCHCHLRVVQCSDLGLKTVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNL
Tag	His-Tag at the N-terminus
Predicted MW	14 KDa
Purity	>95%, determined by SDS-PAGE and HPLC
Endotoxin Level	<1 EU/μg, determined by the LAL method
Conjugation	Unconjugated

Target	BGN
Full Name	Biglycan
Gene ID	25181
Uniprot ID	P47853
Accession Number	NP_058783.1
Background	This protein may play a role in vascular remodeling.
Alternate Names	BSPG1; BGN; Biglycan