0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Mouse Biglycan (BGN) protein (Leu53-Arg166) [His-Tag], E. coli (CAT#: GP01-030J)

Datasheet
SizeQtyAdd To Basket
10 μg
50 μg
200 μg

Product Overview Recombinant Mouse Biglycan (BGN) protein (NP_031568.2) (Leu53-Arg166) was expressed in E. coli with a His-Tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Biological Activity Determined by its binding ability in a functional ELISA.
Source E. coli
Species Mouse
Fragment Leu53-Arg166
Sequence MGHHHHHHSGSEFLDSVTPTFSAMCPFGCHCHLRVVQCSDLGLKTVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELR
Tag His-Tag at the N-terminus
Predicted MW 14.4 KDa
Purity >95%, determined by SDS-PAGE and HPLC
Endotoxin Level <1 EU/μg, determined by the LAL method
Conjugation Unconjugated
Target BGN
Full Name Biglycan
Gene ID 12111
Uniprot ID P28653
Accession Number NP_031568.2
Background This gene encodes a small, leucine-rich repeat proteoglycan that plays important roles in bone mineralization and connective tissue metabolism. The encoded preproprotein undergoes post-translational processing during which chondroitin sulfate or dermatan sulfate chains are attached before incorporation into the extracellular matrix. Mice lacking the encoded protein exhibit reduced growth rate and acquire diminished bone mass progressively with age.
Alternate Names S; BG; PGI; DSPG1; PG-S1; SLRR1A; BGN; Biglycan
For Research Use Only.
Online Inquiry
Creative Biolabs-Glycoprotein Follow us on
Close
Thanksgiving
Thanksgiving