Book a Meeting

0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Mouse Aggrecan (ACAN) protein (Gly587-Arg684) [His-Tag], E. coli (CAT#: GP01-004J)

Datasheet
SizeQtyAdd To Basket
10 μg
50 μg
200 μg

Product Overview Recombinant Mouse Aggrecan (ACAN) protein (NP_031450.2) (Gly587-Arg684) was expressed in E. coli with a His-Tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Biological Activity Determined by its binding ability in a functional ELISA.
Source E. coli
Species Mouse
Fragment Gly587-Arg684
Sequence MGHHHHHHSGSEFGEVFFATRLEQFTFQEARAFCAAQNATLASTGQLYAAWSQGLDKCYAGWLADGTLRYPIITPRPACGGDKPGVRTVYLYPNQTGLPDPLSKHHAFCFR
Tag His-Tag at the N-terminus
Predicted MW 12.3 KDa
Purity >95%, determined by SDS-PAGE and HPLC
Endotoxin Level <1 EU/μg, determined by the LAL method
Conjugation Unconjugated
Target ACAN
Full Name Aggrecan
Gene ID 11595
Uniprot ID Q61282
Accession Number NP_031450.2
Background Aggrecan is the major proteoglycan in the articular cartilage. This molecule is important in the proper functioning of articular cartilage because it provides a hydrated gel structure (via its interaction with hyaluronan and link protein) that endows the cartilage with load-bearing properties.
Alternate Names Agc; Csp; Cmd; Agc1; CSPCP; Cspg1; b2b183C; b2b183Clo; ACAN; aggrecan
For Research Use Only.
Online Inquiry
  • (USA)
    (UK)
    (Germany)
  • Contact Us
  • Global Locations
Follow us on