Recombinant Mouse Aggrecan (ACAN) protein (Gly587-Arg684) [His-Tag], E. coli (CAT#: GP01-004J)

Product Overview	Recombinant Mouse Aggrecan (ACAN) protein (NP_031450.2) (Gly587-Arg684) was expressed in E. coli with a His-Tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Biological Activity	Determined by its binding ability in a functional ELISA.
Source	E. coli
Species	Mouse
Fragment	Gly587-Arg684
Sequence	MGHHHHHHSGSEFGEVFFATRLEQFTFQEARAFCAAQNATLASTGQLYAAWSQGLDKCYAGWLADGTLRYPIITPRPACGGDKPGVRTVYLYPNQTGLPDPLSKHHAFCFR
Tag	His-Tag at the N-terminus
Predicted MW	12.3 KDa
Purity	>95%, determined by SDS-PAGE and HPLC
Endotoxin Level	<1 EU/μg, determined by the LAL method
Conjugation	Unconjugated

Target	ACAN
Full Name	Aggrecan
Gene ID	11595
Uniprot ID	Q61282
Accession Number	NP_031450.2
Background	Aggrecan is the major proteoglycan in the articular cartilage. This molecule is important in the proper functioning of articular cartilage because it provides a hydrated gel structure (via its interaction with hyaluronan and link protein) that endows the cartilage with load-bearing properties.
Alternate Names	Agc; Csp; Cmd; Agc1; CSPCP; Cspg1; b2b183C; b2b183Clo; ACAN; aggrecan