Book a Meeting

0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Human Aggrecan (ACAN) protein (Asp2163-His2316) [His-tag and S-tag], E. coli (CAT#: GP01-003J)

Datasheet
SizeQtyAdd To Basket
10 μg
50 μg
200 μg

Product Overview Recombinant Human Aggrecan (ACAN) protein (NP_001126.3) (Asp2163-His2316) was expressed in E. coli with a His-tag and S-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Biological Activity Determined by its binding ability in a functional ELISA.
Source E. coli
Species Human
Fragment Asp2163-His2316
Sequence MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEFDQEVCEEGWNKYQGHCYRHFPDRETWVDAERRCREQQSHLSSIVTPEEQEFVNNNAQDYQWIGLNDRTIEGDFRWSDGHPMQFENWRPNQPDNFFAAGEDCVVMIWHEKGEWNDVPCNYHLPFTCKKGTATTYKRRLQKRSSRHPRRSRPSTAH
Tag His-tag and S-tag at the N-terminus
Predicted MW 24.2 KDa
Purity >95%, determined by SDS-PAGE and HPLC
Endotoxin Level <1 EU/μg, determined by the LAL method
Conjugation Unconjugated
Target ACAN
Full Name Aggrecan
Gene ID 176
Uniprot ID P16112
Accession Number NP_001126.3
Background This gene is a member of the aggrecan/versican proteoglycan family. The encoded protein is an integral part of the extracellular matrix in cartilagenous tissue and it withstands compression in cartilage. Mutations in this gene may be involved in skeletal dysplasia and spinal degeneration. Multiple alternatively spliced transcript variants that encode different protein isoforms have been observed in this gene.
Alternate Names AGC1; SEDK; AGCAN; CSPG1; MSK16; CSPGCP; SSOAOD; ACAN; Aggrecan
For Research Use Only.
Online Inquiry
  • (USA)
    (UK)
    (Germany)
  • Contact Us
  • Global Locations
Follow us on