0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Rat Aggrecan (ACAN) protein (Glu588-Arg684) [His-Tag], E. coli (CAT#: GP01-006J)

Datasheet
SizeQtyAdd To Basket
10 μg
50 μg
200 μg

Product Overview Recombinant Rat Aggrecan (ACAN) protein (NP_071526.1) (Glu588-Arg684) was expressed in E. coli with a His-Tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Biological Activity Determined by its binding ability in a functional ELISA.
Source E. coli
Species Rat
Fragment Glu588-Arg684
Sequence MGHHHHHHSGSEFEVFFATQMEQFTFQEAQAFCAAQNATLASTGQLYAAWSQGLDKCYAGWLADGTLRYPIVNPRPACGGDKPGVRTVYLYPNQTGLPDPLSKHHAFCFR
Tag His-Tag at the N-terminus
Predicted MW 12.2 KDa
Purity >95%, determined by SDS-PAGE and HPLC
Endotoxin Level <1 EU/μg, determined by the LAL method
Conjugation Unconjugated
Target ACAN
Full Name Aggrecan
Gene ID 58968
Uniprot ID P07897
Accession Number NP_071526.1
Background This protein is an extracellular matrix proteoglycan; cleaved by ADAMTS1.
Alternate Names Agc; Agc1; ACAN; Aggrecan
For Research Use Only.
Online Inquiry
Creative Biolabs-Glycoprotein Follow us on
Close
Thanksgiving
Thanksgiving