Recombinant Rat Aggrecan (ACAN) protein (Glu588-Arg684) [His-Tag], E. coli (CAT#: GP01-006J)

Product Overview	Recombinant Rat Aggrecan (ACAN) protein (NP_071526.1) (Glu588-Arg684) was expressed in E. coli with a His-Tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Biological Activity	Determined by its binding ability in a functional ELISA.
Source	E. coli
Species	Rat
Fragment	Glu588-Arg684
Sequence	MGHHHHHHSGSEFEVFFATQMEQFTFQEAQAFCAAQNATLASTGQLYAAWSQGLDKCYAGWLADGTLRYPIVNPRPACGGDKPGVRTVYLYPNQTGLPDPLSKHHAFCFR
Tag	His-Tag at the N-terminus
Predicted MW	12.2 KDa
Purity	>95%, determined by SDS-PAGE and HPLC
Endotoxin Level	<1 EU/μg, determined by the LAL method
Conjugation	Unconjugated

Target	ACAN
Full Name	Aggrecan
Gene ID	58968
Uniprot ID	P07897
Accession Number	NP_071526.1
Background	This protein is an extracellular matrix proteoglycan; cleaved by ADAMTS1.
Alternate Names	Agc; Agc1; ACAN; Aggrecan