There is no product in the shopping cart, buy it!
Size | Qty | Add To Basket |
---|---|---|
10 μg | ||
50 μg | ||
200 μg |
Product Overview | Recombinant Rat Aggrecan (ACAN) protein (NP_071526.1) (Glu588-Arg684) was expressed in E. coli with a His-Tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP. |
Biological Activity | Determined by its binding ability in a functional ELISA. |
Source | E. coli |
Species | Rat |
Fragment | Glu588-Arg684 |
Sequence | MGHHHHHHSGSEFEVFFATQMEQFTFQEAQAFCAAQNATLASTGQLYAAWSQGLDKCYAGWLADGTLRYPIVNPRPACGGDKPGVRTVYLYPNQTGLPDPLSKHHAFCFR |
Tag | His-Tag at the N-terminus |
Predicted MW | 12.2 KDa |
Purity | >95%, determined by SDS-PAGE and HPLC |
Endotoxin Level | <1 EU/μg, determined by the LAL method |
Conjugation | Unconjugated |
Target | ACAN |
Full Name | Aggrecan |
Gene ID | 58968 |
Uniprot ID | P07897 |
Accession Number | NP_071526.1 |
Background | This protein is an extracellular matrix proteoglycan; cleaved by ADAMTS1. |
Alternate Names | Agc; Agc1; ACAN; Aggrecan |