Recombinant Human Aggrecan (ACAN) protein (Pro34-Glu147) [His-tag and S-tag], E. coli (CAT#: GP01-002J)

Product Overview	Recombinant Human Aggrecan (ACAN) protein (NP_001126.3) (Pro34-Glu147) was expressed in E. coli with a His-tag and S-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Biological Activity	Determined by its binding ability in a functional ELISA.
Source	E. coli
Species	Human
Fragment	Pro34-Glu147
Sequence	MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEFPQPSPLRVLLGTSLTIPCYFIDPMHPVTTAPSTAPLAPRIKWSRVSKEKEVVLLVATEGRVRVNSAYQDKVSLPNYPAIPSDATLEVQSLRSNDSGVYRCEVMHGIEDSEATLE
Tag	His-tag and S-tag at the N-terminus
Predicted MW	18.2 KDa
Purity	>95%, determined by SDS-PAGE and HPLC
Endotoxin Level	<1 EU/μg, determined by the LAL method
Conjugation	Unconjugated

Target	ACAN
Full Name	Aggrecan
Gene ID	176
Uniprot ID	P16112
Accession Number	NP_001126.3
Background	This gene is a member of the aggrecan/versican proteoglycan family. The encoded protein is an integral part of the extracellular matrix in cartilagenous tissue and it withstands compression in cartilage. Mutations in this gene may be involved in skeletal dysplasia and spinal degeneration. Multiple alternatively spliced transcript variants that encode different protein isoforms have been observed in this gene.
Alternate Names	AGC1; SEDK; AGCAN; CSPG1; MSK16; CSPGCP; SSOAOD; ACAN; Aggrecan