Recombinant Human CD8a molecule (CD8A) (22-182 aa) [His-Tag], Yeast (CAT#: GP02-016J)

Product Overview	Recombinant Human CD8a molecule (NP_001759.3) (22-182 aa) was expressed in Yeast with a 6xHis-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Source	Yeast
Species	Human
Fragment	22-182 aa
Sequence	SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD
Tag	6xHis-tag at the N-terminus
Predicted MW	19.6 kDa
Purity	>95%, determined by SDS-PAGE.
Conjugation	Unconjugated

Target	CD8A
Full Name	CD8a molecule
Gene ID	925
Uniprot ID	P01732
Accession Number	NP_001759.3
Background	The CD8 antigen is a cell surface glycoprotein found on most cytotoxic T lymphocytes that mediates efficient cell-cell interactions within the immune system. The CD8 antigen acts as a coreceptor with the T-cell receptor on the T lymphocyte to recognize antigens displayed by an antigen presenting cell in the context of class I MHC molecules. The coreceptor functions as either a homodimer composed of two alpha chains or as a heterodimer composed of one alpha and one beta chain. Both alpha and beta chains share significant homology to immunoglobulin variable light chains. This gene encodes the CD8 alpha chain. Multiple transcript variants encoding different isoforms have been found for this gene. The major protein isoforms of this gene differ by the presence or absence of a transmembrane domain and thus differ in being a membrane-anchored or secreted protein.
Alternate Names	CD8; p32; Leu2