0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Human T-cell surface glycoprotein CD8 alpha chain (CD8A) (22-182 aa) [6xHis-SUMO-tag], E. coli (CAT#: GPX04-129J)

Datasheet
SizeQtyAdd To Basket
1 mg
500 μg
100 μg

Product Overview Recombinant Human T-cell surface glycoprotein CD8 alpha chain (NP_001139345.1) (22-182 aa) was expressed in E. coli with a 6xHis-SUMO-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP.
Biological Activity Determined by its binding ability in a functional ELISA.
Source E. coli
Species Human
Fragment 22-182 aa
Sequence SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD
Tag 6xHis-SUMO-tag at the N-terminus
Predicted MW 33.6 kDa
Purity >90%, determined by SDS-PAGE.
Conjugation Unconjugated
Target CD8A
Full Name T-cell surface glycoprotein CD8 alpha chain
Gene ID 925
Uniprot ID P01732
Accession Number NP_001139345.1
Background Integral membrane glycoprotein that plays an essential role in the immune response and serves multiple functions in responses against both external and internal offenses. In T-cells, functions primarily as a coreceptor for MHC class I molecule:peptide complex. The antigens presented by class I peptides are derived from cytosolic proteins while class II derived from extracellular proteins. Interacts simultaneously with the T-cell receptor (TCR) and the MHC class I proteins presented by antigen presenting cells (APCs).
Alternate Names T-lymphocyte differentiation antigen T8/Leu-2; CD8a
For Research Use Only.
Online Inquiry
Creative Biolabs-Glycoprotein Follow us on