0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Sudan ebolavirus (SEBOV) (strain Human/Uganda/Gulu/2000) Envelopment polyprotein (GP) (502-637 aa) [6xHis-tag], Mammalian cell (CAT#: GPX04-415J)

Datasheet
SizeQtyAdd To Basket
1 mg
500 μg
100 μg

Product Overview Recombinant Sudan ebolavirus (SEBOV) (strain Human/Uganda/Gulu/2000) Envelopment polyprotein (3160774) (502-637 aa) was expressed in Mammalian cell with a 6xHis-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP.
Biological Activity Determined by its binding ability in a functional ELISA.
Source Mammalian cell
Species Sudan ebolavirus (SEBOV) (strain Human/Uganda/Gulu/2000)
Fragment 502-637 aa
Sequence QTNTKATGKCNPNLHYWTAQEQHNAAGIAWIPYFGPGAEGIYTEGLMHNQNALVCGLRQLANETTQALQLFLRATTELRTYTILNRKAIDFLLRRWGGTCRILGPDCCIEPHDWTKNITDKINQIIHDFIDNPLPN
Tag 6xHis-tag at the N-terminus
Predicted MW 19.4 kDa
Purity >90%, determined by SDS-PAGE.
Conjugation Unconjugated
Target GP
Full Name Envelopment polyprotein
Gene ID 3160774
Uniprot ID Q7T9D9
Background Trimeric GP1,2 complexes form the virion surface spikes and mediate the viral entry processes, with GP1 acting as the receptor-binding subunit and GP2 as the membrane fusion subunit.
Alternate Names Envelopment polyprotein
For Research Use Only.
Online Inquiry
Creative Biolabs-Glycoprotein Follow us on