0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Human herpesvirus 1 (HHV-1) (strain 17) Envelope glycoprotein G (gG) (25-189 aa) [6xHis-SUMO-tag], E. coli (CAT#: GPX04-167J)

Datasheet
SizeQtyAdd To Basket
1 mg
500 μg
100 μg

Product Overview Recombinant Human herpesvirus 1 (HHV-1) (strain 17) Envelope glycoprotein G (25-189 aa) was expressed in E. coli with a 6xHis-SUMO-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP.
Biological Activity Determined by its binding ability in a functional ELISA.
Source E. coli
Species Human herpesvirus 1 (HHV-1) (strain 17)
Fragment 25-189 aa
Sequence VPTNVSSTTQPQLQTTGRPSHEAPNMTQTGTTDSPTAISLTTPDHTPPMPSIGLEEEEEEEGAGDGEHLEGGDGTRDTLPQSPGPAFPLAEDVEKDKPNRPVVPSPDPNNSPARPETSRPKTPPTIIGPLATRPTTRLTSKGRPLVPTPQHTPLFSFLTASPALD
Tag 6xHis-SUMO-tag at the N-terminus
Predicted MW 33.4 kDa
Purity >90%, determined by SDS-PAGE.
Conjugation Unconjugated
Target gG
Full Name Envelope glycoprotein G
Gene ID 2703401
Uniprot ID P06484
Background Chemokine-binding protein that inhibits neutrophils' chemotaxis.
Alternate Names gG; gG-1
For Research Use Only.
Online Inquiry
Creative Biolabs-Glycoprotein Follow us on
  • ()
    ()
    ()
ISO 9001 Certified - Creative Biolabs Quality Management System.