0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Human Microfibril-associated glycoprotein 3 (MFAP3) (19-362 aa), E. coli (CAT#: GPX04-141J)

Datasheet
SizeQtyAdd To Basket
1 mg
500 μg
100 μg

Product Overview Recombinant Human Microfibril-associated glycoprotein 3 (NP_001128509.1) (19-362 aa) was expressed in E. coli with a His-tag or Tag free. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP.
Biological Activity Determined by its binding ability in a functional ELISA.
Source E. coli
Species Human
Fragment 19-362 aa
Sequence AFVLEDVDFDQMVSLEANRSSYNASFPSSFELSASSHSDDDVIIAKEGTSVSIECLLTASHYEDVHWHNSKGQQLDGRSRGGKWLVSDNFLNITNVAFDDRGLYTCFVTSPIRASYSVTLRVIFTSGDMSVYYMIVCLIAFTITLILNVTRLCMMSSHLRKTEKAINEFFRTEGAEKLQKAFEIAKRIPIITSAKTLELAKVTQFKTMEFARYIEELARSVPLPPLILNCRAFVEEMFEAVRVDDPDDLGERIKERPALNAQGGIYVINPEMGRSNSPGGDSDDGSLNEQGQEIAVQVSVHLQSETKSIDTESQGSSHFSPPDDIGSAESNCNYKDGAYENCQL
Tag His-tag or Tag free
Purity >90%, determined by SDS-PAGE.
Conjugation Unconjugated
Target MFAP3
Full Name Microfibril-associated glycoprotein 3
Gene ID 4238
Uniprot ID P55082
Accession Number NP_001128509.1
Background Component of the elastin-associated microfibrils.
Alternate Names Microfibril-associated glycoprotein 3
For Research Use Only.
Online Inquiry
Creative Biolabs-Glycoprotein Follow us on