Recombinant Lassa virus (LASV) Pre-glycoprotein polyprotein GP complex (GPC) (59-259 aa) [10xHis-tag and Myc-tag], E. coli

Recombinant Lassa virus (LASV) (strain Mouse /Sierra Leone/Josiah/1976) Pre-glycoprotein polyprotein GP complex (NP_694870.1) (59-259 aa) was expressed in E. coli with a 10xHis-tag at the N-terminus and a Myc-tag at the C-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP.

Determined by its binding ability in a functional ELISA.

Lassa virus (LASV) (strain Mouse/Sierra Leone/Josiah/1976)

59-259 aa

TSLYKGVYELQTLELNMETLNMTMPLSCTKNNSHHYIMVGNETGLELTLTNTSIINHKFCNLSDAHKKNLYDHALMSIISTFHLSIPNFNQYEAMSCDFNGGKISVQYNLSHSYAGDAANHCGTVANGVLQTFMRMAWGGSYIALDSGRGNWDCIMTSYQYLIIQNTTWEDHCQFSRPSPIGYLGLLSQRTRDIYISRRLL

10xHis-tag at the N-terminus and Myc-tag at the C-terminus

27.8 kDa

>90%, determined by SDS-PAGE.

Unconjugated

GPC

Pre-glycoprotein polyprotein GP complex

Glycoprotein G2 is a class I viral fusion protein that directs fusion of viral and host endosomal membranes, leading to delivery of the nucleocapsid into the cytoplasm. Membrane fusion is mediated by irreversible conformational changes induced upon acidification in the endosome. Glycoprotein G1 interacts with the host receptor.

GPC; Pre-GP-C; Stable signal peptide; Glycoprotein G1; Glycoprotein G2