Recombinant Human herpesvirus 4 (HHV-4) (strain B95-8) Glycoprotein BILF2 (BILF2) (18-248 aa), E. coli (CAT#: GPX04-192J)

Product Overview	Recombinant Human herpesvirus 4 (HHV-4) (strain B95-8) Glycoprotein BILF2 (18-248 aa) was expressed in E. coli with a His-tag or Tag free. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP.
Biological Activity	Determined by its binding ability in a functional ELISA.
Source	E. coli
Species	Human herpesvirus 4 (HHV-4) (strain B95-8)
Fragment	18-248 aa
Sequence	FFSDLVKFENVTAHAGARVNLTCSVPSNESVSRIELGRGYTPGDGQLPLAVATSNNGTHI TNGGYNYSLTLEWVNDSNTSVSLIIPNVTLAHAGYYTCNVTLRNCSVASGVHCNYSAGEE DDQYHANRTLTQRMHLTVIPATTIAPTTLVSHTTSTSHRPHRRPVSKRPTHKPVTLGPFP IDPWRPKTTWVHWALLLITCAVVAPVLLIIIISCLGWLAGWGRRRKGWIPL
Tag	His-tag or Tag free
Purity	>90%, determined by SDS-PAGE.
Conjugation	Unconjugated

Target	BILF2
Full Name	Glycoprotein BILF2
Gene ID	3783708
Uniprot ID	P03218
Background	BILF2 is a type 1 membrane protein, found in the virion, which has a protein backbone with a mass of around 28 kDa and a large component of N-linked glycans
Alternate Names	Glycoprotein BILF2