Recombinant Mouse Epithelial cell adhesion molecule (Epcam) (24-266 aa) [His/Myc-Tag], Mammalian cell

Recombinant Mouse Epithelial cell adhesion molecule (NP_032558.2) (24-266 aa) was expressed in Mammalian cell with a 10xHis-tag at the N-terminus and a Myc-tag at the C-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.

Mammalian cell

Mouse

24-266 aa

QRDCVCDNYKLATSCSLNEYGECQCTSYGTQNTVICSKLASKCLAMKAEMTHSKSGRRIKPEGAIQNNDGLYDPDCDEQGLFKAKQCNGTATCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKERESPYDHQSLQTALQEAFTSRYKLNQKFIKNIMYENNVITIDLMQNSSQKTQDDVDIADVAYYFEKDVKGESLFHSSKSMDLRVNGEPLDLDPGQTLIYYVDEKAPEFSMQGLT

10xHis-tag at the N-terminus and Myc-tag at the C-terminus

32.7 kDa

>90%, determined by SDS-PAGE.

Unconjugated

Epcam

Epithelial cell adhesion molecule

This protein may act as a physical homophilic interaction molecule between intestinal epithelial cells (IECs) and intraepithelial lymphocytes (IELs) at the mucosal epithelium for providing immunological barrier as a first line of defense against mucosal infection. Plays a role in embryonic stem cells proliferation and differentiation. Up-regulates the expression of FABP5, MYC and cyclins A and E.

TR; EGP; EpC; Ly7; gp4; EGP-; Ep-C; EpCA; Ly74; gp40; CD326; EGP-2; Egp31; TROP1; Tacst; Egp314; Ep-CAM; EpCAM1; GA733-; Tacsd1; GA733-2; Tacstd1