There is no product in the shopping cart, buy it!
| Size | Qty | Add To Basket |
|---|---|---|
| 1 mg | ||
| 500 μg | ||
| 100 μg |
| Product Overview | Recombinant Porcine transmissible gastroenteritis coronavirus (TGEV) (strain Purdue) Membrane protein (18-262 aa) was expressed in E. coli with a His-tag or Tag free. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP. |
| Biological Activity | Determined by its binding ability in a functional ELISA. |
| Source | E. coli |
| Species | Porcine transmissible gastroenteritis coronavirus (TGEV) (strain Purdue) |
| Fragment | 18-262 aa |
| Sequence | RYCAMKSDTDLSCRNSTASDCESCFNGGDLIWHLANWNFSWSIILIVFITVLQYGRPQFS WFVYGIKMLIMWLLWPVVLALTIFNAYSEYQVSRYVMFGFSIAGAIVTFVLWIMYFVRSI QLYRRTKSWWSFNPETKAILCVSALGRSYVLPLEGVPTGVTLTLLSGNLYAEGFKIAGGM NIDNLPKYVMVALPSRTIVYTLVGKKLKASSATGWAYYVKSKAGDYSTEARTDNLSEQEK LLHMV |
| Tag | His-tag or Tag free |
| Purity | >90%, determined by SDS-PAGE. |
| Conjugation | Unconjugated |
| Target | M |
| Full Name | Membrane protein |
| Uniprot ID | P04135 |
| Background | Component of the viral envelope that plays a central role in virus morphogenesis and assembly via its interactions with other viral proteins. |
| Alternate Names | M protein; E1 glycoprotein; Matrix glycoprotein |