0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Porcine transmissible gastroenteritis coronavirus (TGEV) (strain Purdue) Membrane protein (M) (18-262 aa), E. coli (CAT#: GPX04-342J)

Datasheet
SizeQtyAdd To Basket
1 mg
500 μg
100 μg

Product Overview Recombinant Porcine transmissible gastroenteritis coronavirus (TGEV) (strain Purdue) Membrane protein (18-262 aa) was expressed in E. coli with a His-tag or Tag free. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP.
Biological Activity Determined by its binding ability in a functional ELISA.
Source E. coli
Species Porcine transmissible gastroenteritis coronavirus (TGEV) (strain Purdue)
Fragment 18-262 aa
Sequence RYCAMKSDTDLSCRNSTASDCESCFNGGDLIWHLANWNFSWSIILIVFITVLQYGRPQFS WFVYGIKMLIMWLLWPVVLALTIFNAYSEYQVSRYVMFGFSIAGAIVTFVLWIMYFVRSI QLYRRTKSWWSFNPETKAILCVSALGRSYVLPLEGVPTGVTLTLLSGNLYAEGFKIAGGM NIDNLPKYVMVALPSRTIVYTLVGKKLKASSATGWAYYVKSKAGDYSTEARTDNLSEQEK LLHMV
Tag His-tag or Tag free
Purity >90%, determined by SDS-PAGE.
Conjugation Unconjugated
Target M
Full Name Membrane protein
Uniprot ID P04135
Background Component of the viral envelope that plays a central role in virus morphogenesis and assembly via its interactions with other viral proteins.
Alternate Names M protein; E1 glycoprotein; Matrix glycoprotein
For Research Use Only.
Online Inquiry
Creative Biolabs-Glycoprotein Follow us on