Recombinant Canine coronavirus (strain BGF10) Membrane protein (M) (18-262 aa), E. coli (CAT#: GPX04-045J)

Product Overview	Recombinant Canine coronavirus (strain BGF10) Membrane protein (18-262 aa) was expressed in E. coli with a His-tag or Tag free. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP.
Biological Activity	Determined by its binding ability in a functional ELISA.
Source	E. coli
Species	Canine coronavirus (strain BGF10)
Fragment	18-262 aa
Sequence	ENYCAMNSTAQTSCLISGSVCALCFEGGDLVWHLANWNFSWSVILIVFITVLQYGRPQFS WFVYGVKMLIMWLLWPIVLALTIFNAYSEYEVSRYVMFGFSVAGAIVTFILWIMYFVRSI QLYRRTKSWWSFNPETNAILCVSALGRSYVLPLEGVPTGVTLTLLSGNLYAEGFKIAGGM NIDNLPKYVMVALPSRTIVYTLVGKQLKASSATGWAYYVKSKAGDYSTDARTDTLSEHEK LLHMV
Tag	His-tag or Tag free
Purity	>90%, determined by SDS-PAGE.
Conjugation	Unconjugated

Target	M
Full Name	Membrane protein
Uniprot ID	Q7T6S9
Background	Component of the viral envelope that plays a central role in virus morphogenesis and assembly via its interactions with other viral proteins.
Alternate Names	E1 glycoprotein; Matrix glycoprotein; Membrane glycoprotein