0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Feline coronavirus (FCoV) (strain FIPV WSU-79/1146) Membrane protein (M) (18-262 aa), E. coli (CAT#: GPX04-106J)

Datasheet
SizeQtyAdd To Basket
1 mg
500 μg
100 μg

Product Overview Recombinant Feline coronavirus (FCoV) (strain FIPV WSU-79/1146) Membrane protein (18-262 aa) was expressed in E. coli with a His-tag or Tag free. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP.
Biological Activity Determined by its binding ability in a functional ELISA.
Source E. coli
Species Feline coronavirus (FCoV) (strain FIPV WSU-79/1146)
Fragment 18-262 aa
Sequence ERYCAMQDSGLQCINGTNSRCQTCFERGDLIWHLANWNFSWSVILIVFITVLQYGRPQFS WLVYGIKMLIMWLLWPIVLALTIFNAYSEYQVSRYVMFGFSVAGAVVTFALWMMYFVRSV QLYRRTKSWWSFNPETNAILCVNALGRSYVLPLDGTPTGVTLTLLSGNLYAEGFKMAGGL TIEHLPKYVMIATPSRTIVYTLVGKQLKATTATGWAYYVKSKAGDYSTEARTDNLSEHEK LLHMV
Tag His-tag or Tag free
Purity >90%, determined by SDS-PAGE.
Conjugation Unconjugated
Target M
Full Name Membrane protein
Gene ID 10040185
Uniprot ID P25878
Background Component of the viral envelope that plays a central role in virus morphogenesis and assembly via its interactions with other viral proteins.
Alternate Names E1 glycoprotein; Matrix glycoprotein; Membrane glycoprotein
For Research Use Only.
Online Inquiry
Creative Biolabs-Glycoprotein Follow us on