Recombinant Trypanosoma brucei brucei Envelope glycoprotein (GP) (1-92 aa) [His-tag], Yeast (CAT#: GP03-421J)

Product Overview	Recombinant Trypanosoma brucei brucei Envelope glycoprotein (1-92 aa) was expressed in Yeast with a His-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Biological Activity	Determined by its binding ability in a functional ELISA.
Source	Yeast
Species	Trypanosoma brucei brucei
Fragment	1-92 aa
Sequence	DQKGKSPESECNKISEEPKCNEDKICSWHKEVKAGEKHCKFNSTKAKEKGVAVTQTQTAGGTEATTDKCKGKLEDTCKKESNCKWEGETCKD
Tag	His-tag at the N-terminus
Predicted MW	53.5 kDa
Purity	>90%, determined by SDS-PAGE.
Conjugation	Unconjugated

Target	GP
Full Name	Envelope glycoprotein
Uniprot ID	P06017
Background	Glycoprotein G2 and glycoprotein G1 interact with each other and are present at the surface of the virion. They are able to attach the virion to a cell receptor and to promote fusion of membranes after endocytosis of the virion.
Alternate Names	Envelope glycoprotein; Glycoprotein G2; Glycoprotein G1