Recombinant Zaire ebolavirus (strain Eckron-76) Envelopment polyprotein (GP) (502-637 aa) [6xHis-tag], Yeast (CAT#: GPX04-458J)

Product Overview	Recombinant Zaire ebolavirus (strain Eckron-76) Envelopment polyprotein (502-637 aa) was expressed in Yeast with a 6xHis-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP.
Biological Activity	Determined by its binding ability in a functional ELISA.
Source	Yeast
Species	Zaire ebolavirus (strain Eckron-76)
Fragment	502-637 aa
Sequence	EAIVNAQPKCNPNLHYWTTQDEGAAIGLAWIPYFGPAAEGIYTEGLMHNQNGLICGLRQLANETTQALQLFLRATTELRTFSILNRKAIDFLLQRWGGTCHILGPDCCIEPHDWTKNITDKIDQIIHDFVDKTLPD
Tag	6xHis-tag at the N-terminus
Predicted MW	17.3 kDa
Purity	>90%, determined by SDS-PAGE.
Conjugation	Unconjugated

Target	GP
Full Name	Envelopment polyprotein
Uniprot ID	P87671
Background	Trimeric GP1,2 complexes form the virion surface spikes and mediate the viral entry processes, with GP1 acting as the receptor-binding subunit and GP2 as the membrane fusion subunit.
Alternate Names	GP1; GP2; Shed