0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Grass carp Glycoprotein hormones alpha chain (CGA) (24-118 aa) [His-tag], Yeast (CAT#: GP03-060J)

Datasheet
SizeQtyAdd To Basket
100 μg
500 μg
1 mg

Product Overview Recombinant Grass carp Glycoprotein hormones alpha chain (24-118 aa) was expressed in Yeast with a His-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Biological Activity Determined by its binding ability in a functional ELISA.
Source Yeast
Species Grass carp
Fragment 24-118 aa
Sequence YPRNDMTNFGCEECKLKENNIFSKPGAPVYQC mgCCFSRAYPTPLRSKKTMLVPKNITSEATCCVAKEVKRVLVNDVKLVNHTDCHCSTCYYHKS
Tag His-tag at the N-terminus
Predicted MW 12.7 kDa
Purity >90%, determined by SDS-PAGE.
Conjugation Unconjugated
Target CGA
Full Name Glycoprotein hormones alpha chain
Uniprot ID P30983
Background Shared alpha chain of the active heterodimeric glycoprotein hormones thyrotropin/thyroid stimulating hormone/TSH, lutropin/luteinizing hormone/LH and follitropin/follicle stimulating hormone/FSH. These hormones bind specific receptors on target cells that in turn activate downstream signaling pathways.
Alternate Names Anterior pituitary glycoprotein hormones common subunit alpha; Follicle-stimulating hormone alpha chain; FSH-alpha; Follitropin alpha chain
For Research Use Only.
Online Inquiry
Creative Biolabs-Glycoprotein Follow us on