Recombinant Mouse OX-2 membrane glycoprotein (CD200) (31-278 aa), E. coli (CAT#: GPX04-318J)

Product Overview	Recombinant Mouse OX-2 membrane glycoprotein (31-278 aa) was expressed in E. coli with a His-tag or Tag free. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP.
Biological Activity	Determined by its binding ability in a functional ELISA.
Source	E. coli
Species	Mouse
Fragment	31-278 aa
Sequence	QVEVVTQDERKALHTTASLRCSLKTSQEPLIVTWQKKKAVSPENMVTYSKTHGVVIQPAYKDRINVTELGLWNSSITFWNTTLEDEGCYMCLFNTFGSQKVSGTACLTLYVQPIVHLHYNYFEDHLNITCSATARPAPAISWKGTGTGIENSTESHFHSNGTTSVTSILRVKDPKTQVGKEVICQVLYLGNVIDYKQSLDKGFWFSVPLLLSIVSLVILLVLISILLYWKRHRNQERGESSQGMQRMK
Tag	His-tag or Tag free
Purity	>90%, determined by SDS-PAGE.
Conjugation	Unconjugated

Target	CD200
Full Name	OX-2 membrane glycoprotein
Uniprot ID	O54901
Background	Costimulates T-cell proliferation. May regulate myeloid cell activity in a variety of tissues.
Alternate Names	MRC OX-2 antigen; CD200