0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Mouse OX-2 membrane glycoprotein (CD200) (31-278 aa), E. coli (CAT#: GPX04-318J)

Datasheet
SizeQtyAdd To Basket
1 mg
500 μg
100 μg

Product Overview Recombinant Mouse OX-2 membrane glycoprotein (31-278 aa) was expressed in E. coli with a His-tag or Tag free. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP.
Biological Activity Determined by its binding ability in a functional ELISA.
Source E. coli
Species Mouse
Fragment 31-278 aa
Sequence QVEVVTQDERKALHTTASLRCSLKTSQEPLIVTWQKKKAVSPENMVTYSKTHGVVIQPAYKDRINVTELGLWNSSITFWNTTLEDEGCYMCLFNTFGSQKVSGTACLTLYVQPIVHLHYNYFEDHLNITCSATARPAPAISWKGTGTGIENSTESHFHSNGTTSVTSILRVKDPKTQVGKEVICQVLYLGNVIDYKQSLDKGFWFSVPLLLSIVSLVILLVLISILLYWKRHRNQERGESSQGMQRMK
Tag His-tag or Tag free
Purity >90%, determined by SDS-PAGE.
Conjugation Unconjugated
Target CD200
Full Name OX-2 membrane glycoprotein
Uniprot ID O54901
Background Costimulates T-cell proliferation. May regulate myeloid cell activity in a variety of tissues.
Alternate Names MRC OX-2 antigen; CD200
For Research Use Only.
Online Inquiry
Creative Biolabs-Glycoprotein Follow us on