Recombinant Daggertooth pike conger Glycoprotein hormones alpha chain (CGA) (1-93 aa) [His-tag], Baculovirus (CAT#: GP03-221J)

Product Overview	Recombinant Daggertooth pike conger Glycoprotein hormones alpha chain (1-93 aa) was expressed in Baculovirus with a His-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Biological Activity	Determined by its binding ability in a functional ELISA.
Source	Baculovirus
Species	Daggertooth pike conger
Fragment	1-93 aa
Sequence	YPNNEISRGGCDECRLKDNKFFSKPSAPIFQCVGCCFSRAYPTPLRSKKTMLVPKDITSEATCCVAREVTKLDNMKLENHTDCHCSTCYYHKS
Tag	His-tag at the N-terminus
Predicted MW	12.6 kDa
Purity	>90%, determined by SDS-PAGE.
Conjugation	Unconjugated

Target	CGA
Full Name	Glycoprotein hormones alpha chain
Uniprot ID	P12836
Background	Shared alpha chain of the active heterodimeric glycoprotein hormones thyrotropin/thyroid stimulating hormone/TSH, lutropin/luteinizing hormone/LH and follitropin/follicle stimulating hormone/FSH. These hormones bind specific receptors on target cells that in turn activate downstream signaling pathways.
Alternate Names	Anterior pituitary glycoprotein hormones common subunit alpha; Follicle-stimulating hormone alpha chain; FSH-alpha; Follitropin alpha chain