There is no product in the shopping cart, buy it!
| Size | Qty | Add To Basket |
|---|---|---|
| 100 μg | ||
| 500 μg | ||
| 1 mg |
| Product Overview | Recombinant Feline syncytial virus Envelope glycoprotein gp130 (564-982 aa) was expressed in E. coli with a His-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP. |
| Biological Activity | Determined by its binding ability in a functional ELISA. |
| Source | E. coli |
| Species | Feline syncytial virus |
| Fragment | 564-982 aa |
| Sequence | SVSTENLRRIQEAGLGLANAITTVAKISDLNDQKLAKGVHLLRDHVVTLMEANLDDIVSLGEGIQIEHIHNHLTSLKLLTLENRIDWRFINDSWIQEELGVSDNIMKVIRKTARCIPYNVKQTRNLNTSTAWEIYLYYEIIIPTTIYTQNWNIKNLGHLVRNAGYLSKVWIQQPFEVLNQECGTNIYLHMEECVDQDYIICEEVMELPPCGNGTGSDCPVLTKPLTDEYLEIEPLKNGSYLVLSSTTDCGIPAYVPVVITVNDTISCFDKEFKRPLKQELKVTKYAPSVPQLELRVPRLTSLIAKIKGIQIEITSSWETIKEQVARAKAELLRLDLHEGDYPEWLQLLGEATKDVWPTISNFVSGIGNFIKDTAGGIFGTAFSFLGYVKPVLLGFVIIFCIILIIKIIGWLQNTRKKDQ |
| Tag | His-tag at the N-terminus |
| Predicted MW | 49.4 kDa |
| Purity | >90%, determined by SDS-PAGE. |
| Conjugation | Unconjugated |
| Target | Env |
| Full Name | Envelope glycoprotein gp130 |
| Uniprot ID | O56861 |
| Background | The transmembrane protein (TM) acts as a class I viral fusion protein. Under the current model, the protein has at least 3 conformational states: pre-fusion native state, pre-hairpin intermediate state, and post-fusion hairpin state. |
| Alternate Names | Env polyprotein; Envelope glycoprotein gp130 |