0

Inquiry Basket

There is no product in the shopping cart, buy it!

Glyco-engineered Mammalian Cell Expression System Learn More

Knockout and Knockin by Precision Genome Editing Service Learn More

High-throughput Glycan Screening Service Learn More

Hot Products

Monosaccharide Products

L-Mannose [Cat#: GMS0095S]

3-Deoxy-3-fluorosucrose [Cat#: GMS0162S]

GDP-L-[1-13C]fucose disodium salt [Cat#: GMS0273S]

Croscarmellose sodium [Cat#: GMS0366S]

alpha-GalCer [Cat#: GMS0272S]

N-Acetyl-beta-D-glucosaminylamine [Cat#: GMS0009S]

Keto-3-deoxy-D-manno-octulosonic acid [Cat#: GMS0093S]

Momordicoside A [Cat#: GMS0043S]

N-Acetylneuraminic acid [Cat#: GMS0255S]

Benzyl D-Glucuronate [Cat#: GMS0263S]

More ↓

Oligosaccharide Products

Lacto-N-fucopentaose I [Cat#: GOS0167S]

Disialyllacto-N-hexaose I [Cat#: GOS0163S]

3-O-(a-D-Galactopyranosyl)-D-galactopyranose [Cat#: GOS0178S]

b-D-Fructofuranosyl-a-D-galactopyranoside [Cat#: GOS0060S]

a-D-Galactosyl-mannotriose [Cat#: GOS0248S]

N-Acetyl-D-lactosamine [Cat#: GOS0003S]

beta-(1->4)-Galactotriose [Cat#: GOS0042S]

Lactodifucotetraose [Cat#: GOS0226S]

2-O-(b-D-Mannopyranosyl)-D-mannopyranose [Cat#: GOS0241S]

GalNAc(a1-4)GalNAc [Cat#: GOS0200S]

More ↓

Polysaccharide Products

N-Acetyl-de-O-sulfated heparin sodium salt [Cat#: GPS0032S]

Polyguluronic acid [Cat#: GPS0084S]

Furcellaran [Cat#: GPS0011S]

(Hydroxypropyl)methyl cellulose phthalate [Cat#: GPS0080S]

Lipopolysaccharides - from Escherichia coli O55:B5 [Cat#: GPS0082S]

Heparin disaccharide I-H sodium salt [Cat#: GPS0027S]

Arabinoxylan [Cat#: GPS0076S]

Mannan - from Saccharomyces cerevisiae [Cat#: GPS0075S]

Gum arabic [Cat#: GPS0064S]

beta-Glucan [Cat#: GPS0078S]

More ↓

Carbohydrate-based Surfactant Products

Lactonic Sophorolipid [Cat#: GCS0002S]

Cyclohexyl-hexyl-beta-D-maltoside [Cat#: GCS0012S]

2,3-Dihydroxypropyl decanoate [Cat#: GCS0036S]

Octyl beta-D-Galactopyranoside [Cat#: GCS0047S]

6-Deoxy-L-altrose [Cat#: GCS0104S]

2,2-Dihexyl-1,3-propanediylbis(beta-D-glucopyranoside) [Cat#: GCS0008S]

Hexyl beta-D-glucopyranoside [Cat#: GCS0030S]

Nonyl 4-O-alpha-D-Glucopyranosyl-beta-D-Glucopyranoside [Cat#: GCS0043S]

N-Octanoyl-N-methylglucamine [Cat#: GCS0051S]

Octyl-b-D-glucuronide methyl ester [Cat#: GCS0107S]

More ↓

Blood Group Antigen Products

Blood group B type I linear trisaccharide [Cat#: GBG0024S]

Blood group H disaccharide [BSA] [Cat#: GBG0079S]

Lewis X trisaccharide 4-methylumbelliferyl glycoside [Cat#: GBG0016S]

Blood group A pentasaccharide [Cat#: GBG0030S]

Blood group A tetrasaccharide type II [Cat#: GBG0034S]

Blood group B hexasaccharide type II [Cat#: GBG0061S]

Blood group A type I tetrasaccharide [Cat#: GBG0056S]

Blood group H disaccharide [Cat#: GBG0006S]

Blood group B trisaccharide [APE-Biotin-BSA] [Cat#: GBG0064S]

Blood group B trisaccharide, N-aminoethyl nonanamide [Cat#: GBG0073S]

More ↓

Glycoprotein Products

Recombinant Lassa virus (LASV) Pre-glycoprotein polyprotein GP complex (GPC) (59-259 aa) [10xHis-tag and Myc-tag], E. coli [Cat#: GPX04-270J]

Recombinant Avian infectious bronchitis virus (strain D274) (IBV) Spike glycoprotein (S), Yeast [Cat#: GPX-144-Y-J]

Recombinant Rabies virus (RABV) (strain HEP-Flury) Glycoprotein (G) (20-459 aa) [Tag free], E. coli [Cat#: GPX04-363J]

Recombinant Rabies virus (RABV) (strain ERA) (RABV) Glycoprotein (G) (20-459 aa) [6xHis-tag], E. coli [Cat#: GPX04-362J]

Recombinant Mumps virus (strain RW) (MuV) Fusion glycoprotein F0 (F), E. coli, Biotin conjugation [Cat#: GPX-086-EB-J]

Recombinant Human Dystroglycan 1, Wheat germ [Cat#: GP05-209J]

Recombinant Human Alpha-2-glycoprotein 1, zinc-binding (AZGP1) [His-Tag], E. coli [Cat#: GP01-020J]

Recombinant Vesicular stomatitis Indiana virus (VSIV) (strain Mudd-Summers) Glycoprotein G (G) (1-423 aa) [10xHis-tag and Myc-tag], E. coli [Cat#: GPX04-449J]

Recombinant Gibbon ape leukemia virus (GALV) Envelope glycoprotein (ENV), Mammalian cell [Cat#: GPX-196-M-J]

Recombinant Rat Alpha-1-acid glycoprotein (ORM1) (19-205 aa) [Tag free], E. coli [Cat#: GPX04-371J]

More ↓

Glycopeptide Products

Human EPO (144-158): EAISPPDAASAAPLR-OH [Cat#: GLJF-0422-JF99]

Human AFP (241-261): TKLSQKFTKVN(G2F)FTEIQKLVLDC-NH₂, G2= Biantennary Nonasaccharide [Cat#: GLJF-0422-JF31]

Human MUC1 (126-149): PAPGS(STn)T(STn)APPAHGVTSAPDTRPAPG-OH, STn=NeuAcα(2-6)GalNAc [Cat#: GLJF-0422-JF56]

Human MUC1 (126-149): PAPGS(STn)TAPPAHGVTSAPDTRPAPG-OH, STn=Neu5Acα(2-6)GalNAc [Cat#: GLJF-0422-JF51]

Human MUC1 (126-149): PAPGST(STn)APPAHGVTSAPDT(STn)RPAPGC-NH₂, STn=Neu5Acα(2-6)GalNAc [Cat#: GLJF-0422-JF48]

Bovine Fetuin-A (334−348): TPIVGQPS(Tn)IPGGPVR-OH, Tn=α-GalNAc [Cat#: GLJF-0422-JF95]

Human MUC1 (126-145): PAPGST(Tn)APPAHGVTSAPDT(Tn)R-OH, Tn=α-GalNAc [Cat#: GLJF-0422-JF36]

Human AFP (250-255): CGGGVN(Fuc-α(1,6)-GlcNAc)FTEI -NH₂ [Cat#: GLJF-0422-JF34]

Human MUC1 (126-149): PAPGSTAPPAHGVTSAPDT(STn)RPAPG-OH, STn=NeuAcα(2-6)GalNAc [Cat#: GLJF-0422-JF55]

Human MUC1 (135-145): Ac-AHGVT(STF)SAPDTRK(5-FAM)-NH₂, STF=Neu5Acα2,3Galβ1,3GalNAc [Cat#: GLJF-0422-JF49]

More ↓

Nucleotide Sugar Products

CMP-N-acetylneuraminic acid disodium salt [Cat#: GLJF-0125-HX003]

UDP-α-D-galactose disodium salt [Cat#: GLJF-0125-HX002]

Glycoprotein Assay Kits

Quantitative Human AZGP1 (Glycosylated) Sandwich ELISA Kit [Cat#: GLJF-0325-HX27]

Quantitative Human Anti-β2 Glycoprotein Antibody Competitive ELISA Kit [Cat#: GLJF-0225-HX43]

N-Glycan Preparation and Labeling Kit (2-AB) [Cat#: GLJF-0125-HX127]

Glycan Clean-Up Kit (Post‑Labeling) [Cat#: GLJF-0125-HX121]

Quantitative Human NPTXR (Glycosylated) Sandwich ELISA Kit [Cat#: GLJF-0525-HX119]

Quantitative Human ANGⅡR-1 (Glycosylated) Sandwich ELISA Kit [Cat#: GLJF-0125-HX64]

Quantitative Rat C4 (Glycosylated) Sandwich ELISA Kit [Cat#: GLJF-0325-HX79]

Quantitative Human FURIN (Glycosylated) Sandwich ELISA Kit [Cat#: GLJF-0325-HX395]

Quantitative Mouse BMP6 (Glycosylated) Sandwich ELISA Kit [Cat#: GLJF-0325-HX51]

Quantitative Human CPN1 (Glycosylated) Sandwich ELISA Kit [Cat#: GLJF-0325-HX211]

More ↓

Comprehensive Glycoprotein Reagents

MEM Media for SILAC [Cat#: GLJF-0225-HX42]

Carboxypeptidase Y [Cat#: GLJF-0225-HX11]

Hydrazide-Biocytin [Cat#: GLJF-0225-HX5]

Glu-C Protease, Sequencing Grade [Cat#: GLJF-0225-HX22]

IMDM Media for SILAC [Cat#: GLJF-0225-HX39]

L-Arginine-HCl for SILAC [Cat#: GLJF-0225-HX27]

L-Leucine for SILAC [Cat#: GLJF-0225-HX30]

κ-Maleimidoundecanoic Acid Hydrazide (KMUH) [Cat#: GLJF-0225-HX3]

Immobilized Papain (Agarose Resin) [Cat#: GLJF-0225-HX13]

DMEM F12 for SILAC [Cat#: GLJF-0225-HX33]

More ↓

Glycoengineered Cell Products

GlycoErase™ SLC35A1 Knockout Jurkat Cell Line [Cat#: GLJF-0425-JF1230]

GlycoErase™ B4GAT1 Knockout HepG2 Cell Line [Cat#: GLJF-0425-JF1152]

GlycoErase™ HEK293T FUT8 Knockout Cell Line [Cat#: GLJF-0425-JF409]

GlycoErase™ FUT9 Knockout Jurkat Cell Line [Cat#: GLJF-0425-JF1178]

GlycoErase™ SLC35A1 Knockout A549 Cell Line [Cat#: GLJF-0425-JF590]

GlycoErase™ FUT8 Knockout CHO-K1 Cell Line [Cat#: GLJF-0425-JF25]

GlycoErase™ SLC35A1 Knockout CHO-K1 Cell Line [Cat#: GLJF-0425-JF78]

GlycoErase™ FUT8 Knockout IST-Mes2 Cell Line [Cat#: GLJF-0425-JF921]

GlycoErase™ B4GAT1 Knockout Jurkat Cell Line [Cat#: GLJF-0425-JF1280]

GlycoErase™ SLC35A1 Knockout KD Cell Line [Cat#: GLJF-0425-JF718]

More ↓

Glycoengineering Viral Particle Products

GlycoFlux™ AAV1-Human ST6GALNAC1 Viral Particle [Cat#: GLJF-1025-JF897]

GlycoFlux™ MSCV-Human ST6GALNAC1 Viral Particle [Cat#: GLJF-1025-JF640]

GlycoFlux™ MMLV-Human ST6GALNAC1 Viral Particle [Cat#: GLJF-1025-JF383]

GlycoFlux™ Lenti-Human ST3GAL4 Viral Particle [Cat#: GLJF-1025-JF121]

GlycoFlux™ AAV1-Human FUT8 Viral Particle [Cat#: GLJF-1025-JF815]

GlycoFlux™ Lenti-Human ST6GALNAC1 Viral Particle [Cat#: GLJF-1025-JF126]

GlycoFlux™ Lenti-Human SLC35A5 Viral Particle [Cat#: GLJF-1025-JF113]

GlycoFlux™ MSCV-Human FUT8 Viral Particle [Cat#: GLJF-1025-JF558]

GlycoFlux™ Lenti-Human SLC35A4 Viral Particle [Cat#: GLJF-1025-JF112]

GlycoFlux™ Lenti-Human SIGLEC6 Viral Particle [Cat#: GLJF-1025-JF106]

More ↓

Glycolipid Products

Monolauroylglycerin [Cat#: GLJF-1125-HX46]

Ceramide-1-phosphate (d18:1/18:0) [Cat#: GLJF-1125-HX77]

1-Stearoyl-2-oleoyl-sn-glycero-3-phosphoethanol [Cat#: GLJF-1125-HX31]

Ins(1,3)P2 [Cat#: GLJF-1125-HX89]

DSPA [Cat#: GLJF-1125-HX20]

4A3-SC8 [Cat#: GLJF-1125-HX71]

Biotin-Cer [Cat#: GLJF-1125-HX201]

Oleyl lysophosphatidic acid [Cat#: GLJF-1125-HX152]

Sorbitan stearate [Cat#: GLJF-1125-HX42]

Biotin Ins(1,3,4,5)P4 [Cat#: GLJF-1125-HX210]

More ↓

Recombinant Psittacid herpesvirus 1 (PsHV-1) (isolate Amazon parrot/-/97-0001/1997) Envelope glycoprotein D (US6) (31-383 aa), E. coli

CAT#: GPX04-345J

Size

Quantity

Datasheet Request COA

Specifications Target Information Related Products

Specifications

Product Overview

Recombinant Psittacid herpesvirus 1 (PsHV-1) (isolate Amazon parrot/-/97-0001/1997) Envelope glycoprotein D (NP_944448.1) (31-383 aa) was expressed in E. coli with a His-tag or Tag free. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP.

Biological Activity

Determined by its binding ability in a functional ELISA.

Source

E. coli

Species

Psittacid herpesvirus 1 (PsHV-1) (isolate Amazon parrot/-/97-0001/1997)

Fragment

31-383 aa

Sequence

AILGAGGAPSPARIVDYLIGYTRVGDMDKLYSQYADRYLDVTLHGCERAVVDPLGDMRHV LASEGASGQEFTASVIWYYVFPDVCFAPVFRREYLRCIRPRKLEDCYTTSPFMWTREFYV DAFLAGSGTGIELLGLNKKLTGTYMLVVRVGTTTRTALVTVNVVGECPTTMEEVTTTLRG NCWRGRQYTTDFNGDGMYLFDTEEEHRRIVYKAYQDKLKVASPNATDAPISYPRAYTGAD ERLAPYTLQPVSTDDHYLPGCPWGIGCDLDQTSASGVIEIEDHDESDVRLVSYPPPTLPS PGPGGNENGAGYSDNRPDPKVVGPTVGPGAIILVVMCAPILIGLTAFTIRKYC

Tag

His-tag or Tag free

Purity

>90%, determined by SDS-PAGE.

Conjugation

Unconjugated

Target Information

Target

US6

Full Name

Envelope glycoprotein D

Gene ID

Uniprot ID

Accession Number

Background

Envelope glycoprotein that binds to host cell entry receptors. May trigger fusion with host membrane, by recruiting the fusion machinery composed of gB and gH/gL.

Alternate Names

Envelope glycoprotein D

Recombinant HHV-5 (strain AD169) Unique short US6 glycoprotein (US6), E. coli, Biotin conjugation (CAT#: GPX-151-EB-J)
Recombinant HHV-5 (strain AD169) Unique short US6 glycoprotein (US6), Baculovirus (CAT#: GPX-151-B-J)
Recombinant HHV-5 (strain AD169) Unique short US6 glycoprotein (US6), Yeast (CAT#: GPX-151-Y-J)
Recombinant HHV-5 (strain AD169) Unique short US6 glycoprotein (US6), E. coli (CAT#: GPX-151-E-J)
Recombinant Pacheco's disease virus Envelope glycoprotein D (31-383 aa), E. coli (CAT#: GP05-332J)
Recombinant HHV-5 (strain AD169) Unique short US6 glycoprotein (US6), Mammalian cell (CAT#: GPX-151-M-J)

For Research Use Only.

Online Inquiry

Copyright © Creative Biolabs. All Rights Reserved.