Recombinant Rat T-cell surface glycoprotein CD8 beta chain (CD8B) (22-208 aa), E. coli (CAT#: GPX04-382J)

Product Overview	Recombinant Rat T-cell surface glycoprotein CD8 beta chain (NP_113727.1) (22-208 aa) was expressed in E. coli with a His-tag or Tag free. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP.
Biological Activity	Determined by its binding ability in a functional ELISA.
Source	E. coli
Species	Rat
Fragment	22-208 aa
Sequence	LLQTPSSLLVQTNQTAKMSCEAKTFPKGTTIYWLRELQDSNKNKHFEFLASRTSTKGIKYGERVKKNMTLSFNSTLPFLKIMDVKPEDSGFYFCAMVGSPMVVFGTGTKLTVVDVLPTTAPTKKTTLKKKQCPTPHPKTQKGLTCGLITLSLLVACILVLLVSLSVAIHFHCMRRRARIHFMKQFHK
Tag	His-tag or Tag free
Purity	>90%, determined by SDS-PAGE.
Conjugation	Unconjugated

Target	CD8B
Full Name	T-cell surface glycoprotein CD8 beta chain
Gene ID	24931
Uniprot ID	P05541
Accession Number	NP_113727.1
Background	Integral membrane glycoprotein that plays an essential role in the immune response and serves multiple functions in responses against both external and internal offenses. In T-cells, functions primarily as a coreceptor for MHC class I molecule:peptide complex. The antigens presented by class I peptides are derived from cytosolic proteins while class II derived from extracellular proteins. Interacts simultaneously with the T-cell receptor (TCR) and the MHC class I proteins presented by antigen presenting cells (APCs).
Alternate Names	CD8 antigen 37 kDa chain; OX-8 membrane antigen; CD8b