Recombinant Rat T-cell surface glycoprotein CD8 beta chain (CD8B) (22-208 aa), E. coli

Recombinant Rat T-cell surface glycoprotein CD8 beta chain (NP_113727.1) (22-208 aa) was expressed in E. coli with a His-tag or Tag free. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP.

Determined by its binding ability in a functional ELISA.

Rat

22-208 aa

LLQTPSSLLVQTNQTAKMSCEAKTFPKGTTIYWLRELQDSNKNKHFEFLASRTSTKGIKYGERVKKNMTLSFNSTLPFLKIMDVKPEDSGFYFCAMVGSPMVVFGTGTKLTVVDVLPTTAPTKKTTLKKKQCPTPHPKTQKGLTCGLITLSLLVACILVLLVSLSVAIHFHCMRRRARIHFMKQFHK

His-tag or Tag free

>90%, determined by SDS-PAGE.

Unconjugated

CD8B

T-cell surface glycoprotein CD8 beta chain

Integral membrane glycoprotein that plays an essential role in the immune response and serves multiple functions in responses against both external and internal offenses. In T-cells, functions primarily as a coreceptor for MHC class I molecule:peptide complex. The antigens presented by class I peptides are derived from cytosolic proteins while class II derived from extracellular proteins. Interacts simultaneously with the T-cell receptor (TCR) and the MHC class I proteins presented by antigen presenting cells (APCs).

CD8 antigen 37 kDa chain; OX-8 membrane antigen; CD8b