Recombinant Bornean orangutan T-cell surface glycoprotein CD8 beta chain (CD8B) (22-210 aa), E. coli (CAT#: GPX04-010J)

Product Overview	Recombinant Bornean orangutan T-cell surface glycoprotein CD8 beta chain (22-210 aa) was expressed in E. coli with a His-tag or Tag free. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP.
Biological Activity	Determined by its binding ability in a functional ELISA.
Source	E. coli
Species	Bornean orangutan
Fragment	22-210 aa
Sequence	LQQTPAYIKVQTNKMVMLSCEAKISLSNMRIYWLRQRQAPSSDSHHEFLALWDSAKGTIHSEEVEQEKVAVFRDASRFILNLTSVKPEDSGIYFCMIVGSPELTFGKGTQLSVVDFLPTTAQPTKKSTPKRRVCRLPRPETQKGPLCSPITLGLLVAGVLVLLVSLGVAIHLCCRRRRARLRFMKQFYK
Tag	His-tag or Tag free
Purity	>90%, determined by SDS-PAGE.
Conjugation	Unconjugated

Target	CD8B
Full Name	T-cell surface glycoprotein CD8 beta chain
Uniprot ID	P30434
Background	CD8 on thymocytes and thymus-derived T cells consists of disulfide-linked CD8alpha and CD8 beta chains, which are transmembrane proteins containing N-terminal Ig domains, extended and glycosylated hinge and stalk regions and transmembrane and cytoplasmic portions.
Alternate Names	CD8 antigen 37 kDa chain; OX-8 membrane antigen; CD8b