0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Walleye dermal sarcoma virus (WDSV) Envelope glycoprotein (Env) (469-1160 aa) [His-tag], E. coli (CAT#: GP03-524J)

Datasheet
SizeQtyAdd To Basket
100 μg
500 μg
1 mg

Product Overview Recombinant Walleye dermal sarcoma virus (WDSV) Envelope glycoprotein (469-1160 aa) was expressed in E. coli with a His-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Biological Activity Determined by its binding ability in a functional ELISA.
Source E. coli
Species Walleye dermal sarcoma virus (WDSV)
Fragment 469-1160 aa
Sequence DLGIGLHSTLNSWWNGANSLGLTVESADRQKYDQKILKVLQNLAVQQRTDVKNQQTLGKALETPIYTITLQLADSLTAAILKHEQQQNVGITCKDIAILTVTQIATYLRDIQHEHLPVWFIEQITNQILLPVGQVIMPEITAPPILNPLIGWNQSVLVIGLTHQLTITTVQQPLYKAAN mgNFQDWTPFPPFILANKTHGFSIDCPIMRNSFLCHTLPTPVKLSEWERSTSTIYQTSPQVWITPEGKACLNHRNITVQDRTCLINKPGCFIPKHPWSAGKQTIVPTQYIQQNFVPDTIDTEDNQTRVLQKEMIEAISKAKRDYGVLKQGQIALIRHHEAITTILGQEATYSIKETQALISSIEQEAWYNNLFSWYDGSVWSQLQLIIVVITCTIPLLWVLNTCLFFKLRRAIRRERDNNIVVEYQAQTRGRRTHMTEPITKKQRAKLLRHAKTNRRLPRSLRATPAVSAFEMVTFDPQEETVEINRIDPSHENNDHGGPMNMAPIISADSYALPTPYITIMLDRELLNQGMRKVITLLNDPAREVFNKAYNLVTTNHFTLAYGCDESAGWVNQHAEY mgKPVIVTLAGLVITPVGLAWIPLPQQEPLEKLFMVPNSMPHVTVAMADYHETKE mgKIVKDINNEELLLVKPQLFKWGPEGFFVACPLVIRGVVTGHSLLHIACPATAVQAEGT
Tag His-tag at the N-terminus
Predicted MW 53.5 kDa
Purity >90%, determined by SDS-PAGE.
Conjugation Unconjugated
Target Env
Full Name Envelope glycoprotein
Uniprot ID Q88938
Background This glycoprotein is responsible for ligand-independent activation of the erythropoietin receptor EPOR leading to the abnormally rapid proliferation of erythroid precursor cells.
Alternate Names Env polyprotein; Envelope glycoprotein
For Research Use Only.
Online Inquiry
Creative Biolabs-Glycoprotein Follow us on