Recombinant Walleye dermal sarcoma virus (WDSV) Envelope glycoprotein (Env) (469-1160 aa) [His-tag], E. coli (CAT#: GP03-524J)

Product Overview	Recombinant Walleye dermal sarcoma virus (WDSV) Envelope glycoprotein (469-1160 aa) was expressed in E. coli with a His-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Biological Activity	Determined by its binding ability in a functional ELISA.
Source	E. coli
Species	Walleye dermal sarcoma virus (WDSV)
Fragment	469-1160 aa
Sequence	DLGIGLHSTLNSWWNGANSLGLTVESADRQKYDQKILKVLQNLAVQQRTDVKNQQTLGKALETPIYTITLQLADSLTAAILKHEQQQNVGITCKDIAILTVTQIATYLRDIQHEHLPVWFIEQITNQILLPVGQVIMPEITAPPILNPLIGWNQSVLVIGLTHQLTITTVQQPLYKAAN mgNFQDWTPFPPFILANKTHGFSIDCPIMRNSFLCHTLPTPVKLSEWERSTSTIYQTSPQVWITPEGKACLNHRNITVQDRTCLINKPGCFIPKHPWSAGKQTIVPTQYIQQNFVPDTIDTEDNQTRVLQKEMIEAISKAKRDYGVLKQGQIALIRHHEAITTILGQEATYSIKETQALISSIEQEAWYNNLFSWYDGSVWSQLQLIIVVITCTIPLLWVLNTCLFFKLRRAIRRERDNNIVVEYQAQTRGRRTHMTEPITKKQRAKLLRHAKTNRRLPRSLRATPAVSAFEMVTFDPQEETVEINRIDPSHENNDHGGPMNMAPIISADSYALPTPYITIMLDRELLNQGMRKVITLLNDPAREVFNKAYNLVTTNHFTLAYGCDESAGWVNQHAEY mgKPVIVTLAGLVITPVGLAWIPLPQQEPLEKLFMVPNSMPHVTVAMADYHETKE mgKIVKDINNEELLLVKPQLFKWGPEGFFVACPLVIRGVVTGHSLLHIACPATAVQAEGT
Tag	His-tag at the N-terminus
Predicted MW	53.5 kDa
Purity	>90%, determined by SDS-PAGE.
Conjugation	Unconjugated

Target	Env
Full Name	Envelope glycoprotein
Uniprot ID	Q88938
Background	This glycoprotein is responsible for ligand-independent activation of the erythropoietin receptor EPOR leading to the abnormally rapid proliferation of erythroid precursor cells.
Alternate Names	Env polyprotein; Envelope glycoprotein